Property Summary

NCBI Gene PubMed Count 40
PubMed Score 234.47
PubTator Score 149.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Maple syrup urine disease 24 3.751 1.9

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.100 2.1e-06
aldosterone-producing adenoma -1.024 3.4e-02
astrocytic glioma 1.600 7.4e-03
atypical teratoid / rhabdoid tumor -1.500 3.6e-06
ependymoma 1.700 1.7e-03
esophageal adenocarcinoma 1.100 2.3e-02
gastric cancer 1.300 8.8e-04
glioblastoma -1.600 1.8e-05
hepatocellular carcinoma 1.100 1.3e-05
interstitial cystitis -1.200 1.3e-02
lung cancer 1.100 4.3e-02
medulloblastoma -1.200 1.8e-05
medulloblastoma, large-cell -1.500 2.4e-05
Multiple myeloma -1.466 1.5e-02
oligodendroglioma 1.600 1.1e-03
osteosarcoma 2.473 1.3e-04
ovarian cancer -1.300 9.4e-04
pancreatic ductal adenocarcinoma liver m... -1.616 4.7e-04
Pick disease 1.100 1.6e-07
primitive neuroectodermal tumor -1.200 3.2e-04
psoriasis 1.300 1.5e-04

Gene RIF (12)

AA Sequence

MAAVRMLRTWSRNAGKLICVRYFQTCGNVHVLKPNYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLS      1 - 70
DIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIET     71 - 140
EALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLE    141 - 210
KQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCD    211 - 280
EIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDT    281 - 350
EQGLIVPNVKNVQICSIFDIATELNRLQKLGSVGQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAI    351 - 420
GALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK            421 - 482
//

Text Mined References (48)

PMID Year Title