Property Summary

NCBI Gene PubMed Count 46
Grant Count 15
R01 Count 11
Funding $1,967,263.95
PubMed Score 171.11
PubTator Score 261.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (33)

PMID Text
24158442 OPRT transition state analogues identify crucial components of potent inhibitors targeting OPRT enzymes.
22931617 OPRT expression in colorectal carcinoma tissues is not correlated with the toxicity of 5-FU, but OPRT expression in the normal tissues can help predict the toxicity associated with 5-FU.
22641663 High expression levels of orotate phosphoribosyl transferase and thymidylate synthase in colorectal cancer appear to be significantly involved in metastasis after curative surgery
22249354 The observed mutations, aberrant splicing and downregulation of UMPS represent novel mechanisms for acquired 5-FU resistance in colorectal cancer
21631301 Although no association was detected between UMPS variants and gastrointestinal cancer risk in Caucasians, polymerase chain reaction-RFLP with BsrI digestion and DHPLC set up at 59 degrees C are reliable and cost-effective methods to genotype UMPS.
20665215 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20647710 orotate phosphoribosyl transferase/DPD ratio has a relation to cancer staging and survival rate.
20647221 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20527751 novel phosphoribosyltransferase transition states
20453000 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDT      1 - 70
VCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQ     71 - 140
KEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAAN    141 - 210
HNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICML    211 - 280
KTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGV    281 - 350
VKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQ    351 - 420
LEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV              421 - 480
//

Text Mined References (55)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24158442 2013 Transition state analogues of Plasmodium falciparum and human orotate phosphoribosyltransferases.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22931617 2012 [Expressions of orotate phosphoribosyltransferase in colorectal carcinoma and its correlations with toxicities of chemotherapy].
22641663 2012 Expression of dihydropyrimidine dehydrogenase, orotate phosphoribosyl transferase and thymidylate synthase in patients with primary colorectal cancer, and associations with site of first metastasis.
22249354 2013 Novel mRNA isoforms and mutations of uridine monophosphate synthetase and 5-fluorouracil resistance in colorectal cancer.
21631301 2011 Frequency of uridine monophosphate synthase Gly(213)Ala polymorphism in Caucasian gastrointestinal cancer patients and healthy subjects, investigated by means of new, rapid genotyping assays.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...