Property Summary

NCBI Gene PubMed Count 102
Grant Count 211
R01 Count 132
Funding $33,788,532.24
PubMed Score 676.50
PubTator Score 373.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -3.690 0.000
group 3 medulloblastoma 2.700 0.004
medulloblastoma, large-cell 2.000 0.019
intraductal papillary-mucinous adenoma (... 1.100 0.001
ovarian cancer 1.300 0.003

Gene

PDB

1GG3   2RQ1   3QIJ  

Gene RIF (54)

PMID Text
25631074 Cellular biotinylated erythrocyte membrane protein band 4.1 (EPB41) protein is incorporated into HIV-1 Gag virus-like particles
24912669 The 4.1R, 4.1N and 4.1B are all expressed at the lateral membrane as well as cytoplasm of epithelial cells, suggesting a potentially redundant role of these proteins.
24607279 We conclude that PIP2 may play an important role as a modulator of apo-CaM binding to 4.1R(80) throughout evolution.
24081810 Calcium mediates the conformation-based 4.1R FERM domain binding to membrane proteins by calmodulin.
23943871 Results suggest a previously unidentified role for the scaffolding protein 4.1R in locally controlling CLASP2 behavior, CLASP2 cortical platform turnover and GSK3 activity, enabling correct MT organization and dynamics essential for cell polarity.
23663475 Plasmodium falciparum PF3D7_0402000 was identified as a new binding partner for the major erythrocyte cytoskeletal protein, 4.1R.
22731252 4.1R regulates NHE1 activity through a direct protein-protein interaction that can be modulated by intracellular pH and Na(+) and Ca(2+) concentrations.
22197999 Further studies involving siRNA-mediated knockdowns of spectrin, adducin, or p4.1 revealed that those proteins are needed for efficient docking of enterohaemorrhagic Escherichia coli to host cells.
22083953 This study characterizes the mechanism by which RBFOX2 regulates protein 4.1R exon 16 splicing through the downstream intronic element UGCAUG.
21848512 apo-calmodulin stabilizes the 4.1R N-terminal domain through interaction with its beta-strand-rich C-lobe and provide a novel function for calmodulin, i.e. structural stabilization of 4.1R
More...

AA Sequence

MTTEKSLVTEAENSQHQQKEEGEEAINSGQQEPQQEESCQTAAEGDNWCEQKLKASNGDTPTHEDLTKNK      1 - 70
ERTSESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGTSLDEEIILKAPIAAPEPELK     71 - 140
TDPSLDLHSLSSAETQPAQEELREDPDFEIKEGEGLEECSKIEVKEESPQSKAETELKASQKPIRKHRNM    141 - 210
HCKVSLLDDTVYECVVEKHAKGQDLLKRVCEHLNLLEEDYFGLAIWDNATSKTWLDSAKEIKKQVRGVPW    211 - 280
NFTFNVKFYPPDPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGVDYV    281 - 350
SDFKLAPNQTKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGL    351 - 420
LVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEQYESTIGFKLPSYRAAKKLWKVCVEHHTFFRLT    421 - 490
STDTIPKSKFLALGSKFRYSGRTQAQTRQASALIDRPAPHFERTASKRASRSLDGAAAVDSADRSPRPTS    491 - 560
APAITQGQVAEGGVLDASAKKTVVPKAQKETVKAEVKKEDEPPEQAEPEPTEAWKVEKTHIEVTVPTSNG    561 - 630
DQTQKLAEKTEDLIRMRKKKRERLDGENIYIRHSNLMLEDLDKSQEEIKKHHASISELKKNFMESVPEPR    631 - 700
PSEWDKRLSTHSPFRTLNINGQIPTGEGPPLVKTQTVTISDNANAVKSEIPTKDVPIVHTETKTITYEAA    701 - 770
QTDDNSGDLDPGVLLTAQTITSETPSSTTTTQITKTVKGGISETRIEKRIVITGDADIDHDQVLVQAIKE    771 - 840
AKEQHPDMSVTKVVVHQETEIADE                                                  841 - 864
//

Text Mined References (110)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24912669 2014 Comprehensive characterization of protein 4.1 expression in epithelium of large intestine.
24607279 2014 Phosphatidylinositol-4,5 bisphosphate (PIP(2)) inhibits apo-calmodulin binding to protein 4.1.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24081810 2014 Unique structural changes in calcium-bound calmodulin upon interaction with protein 4.1R FERM domain: novel insights into the calcium-dependent regulation of 4.1R FERM domain binding to membrane proteins by calmodulin.
23943871 2013 Protein 4.1R binds to CLASP2 and regulates dynamics, organization and attachment of microtubules to the cell cortex.
23663475 2013 A member of the Plasmodium falciparum PHIST family binds to the erythrocyte cytoskeleton component band 4.1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...