Property Summary

Ligand Count 37
NCBI Gene PubMed Count 86
PubMed Score 254.32
PubTator Score 205.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count
Huntington Disease 13

Expression

  Differential Expression (39)

Disease log2 FC p
acute myeloid leukemia 1.700 2.1e-02
adult high grade glioma -1.300 2.6e-02
aldosterone-producing adenoma -1.290 4.1e-02
astrocytic glioma -1.100 1.3e-02
Astrocytoma, Pilocytic -1.200 4.3e-03
atypical teratoid / rhabdoid tumor 1.200 1.8e-02
chronic lymphosyte leukemia -2.200 9.3e-15
cutaneous lupus erythematosus 1.100 1.4e-03
cystic fibrosis 1.202 4.2e-04
ependymoma -1.600 5.9e-03
gastric cancer -1.200 1.1e-03
glioblastoma -1.500 2.7e-03
group 3 medulloblastoma -2.800 1.2e-06
head and neck cancer and chronic obstruc... 1.100 4.4e-03
hepatocellular carcinoma -1.100 2.4e-06
interstitial cystitis 1.200 6.9e-04
intraductal papillary-mucinous adenoma (... -1.400 1.5e-03
intraductal papillary-mucinous carcinoma... -1.600 1.7e-03
intraductal papillary-mucinous neoplasm ... -1.300 1.2e-02
invasive ductal carcinoma -1.100 2.4e-02
lung adenocarcinoma -1.712 2.6e-04
lung cancer -1.800 3.7e-05
lung carcinoma -2.200 5.1e-17
malignant mesothelioma 1.200 2.5e-06
medulloblastoma, large-cell -1.500 1.4e-04
mucosa-associated lymphoid tissue lympho... 2.409 5.5e-03
non-small cell lung cancer -1.082 3.6e-07
oligodendroglioma -1.100 2.9e-02
osteosarcoma -2.849 2.9e-03
ovarian cancer -1.200 3.3e-02
pancreatic cancer 1.100 2.5e-03
periodontitis 1.100 7.6e-18
pituitary cancer -1.100 2.8e-02
primary pancreatic ductal adenocarcinoma 1.022 1.5e-02
primitive neuroectodermal tumor -1.500 7.6e-04
psoriasis -1.400 3.4e-06
Rheumatoid arthritis 1.100 4.9e-02
tuberculosis -1.600 4.0e-03
ulcerative colitis 1.700 1.3e-03

Gene RIF (70)

AA Sequence

MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFINKTLTDKGNAPPSEVLLTSLWSLSVAIF      1 - 70
SVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEMLILGRLVIGLFCGLCTGFVPM     71 - 140
YIGEISPTALRGAFGTLNQLGIVVGILVAQIFGLEFILGSEELWPLLLGFTILPAILQSAALPFCPESPR    141 - 210
FLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQ    211 - 280
QLSGINAVFYYSTGIFKDAGVQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAFCSTLMT    281 - 350
VSLLLKDNYNGMSFVCIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLF    351 - 420
PSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAK    421 - 490
ETTTNV                                                                    491 - 496
//

Text Mined References (87)

PMID Year Title