Property Summary

NCBI Gene PubMed Count 79
PubMed Score 235.34
PubTator Score 205.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
periodontitis 269 7.60046829770283E-18
lung carcinoma 2844 5.06596990554635E-17
non-small cell lung cancer 2798 1.1958476104613E-13
chronic lymphosyte leukemia 232 1.49180366080806E-13
psoriasis 6685 4.16948544938494E-9
ovarian cancer 8492 7.93223245375181E-8
group 3 medulloblastoma 2254 6.4310774119263E-7
pituitary cancer 1972 7.41771145543591E-7
lung cancer 4473 2.36928274667022E-6
malignant mesothelioma 3163 2.54185222598398E-6
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.97680284972308E-6
ulcerative colitis 2087 4.16319637172333E-6
medulloblastoma, large-cell 6234 1.25095565711821E-5
interstitial cystitis 2299 2.59398568616338E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 5.13016666509429E-5
pilocytic astrocytoma 3086 1.99217321418185E-4
lung adenocarcinoma 2714 2.55101425321517E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 2.72053943647587E-4
primitive neuroectodermal tumor 3031 4.30325939658877E-4
cystic fibrosis 1670 4.56982529406418E-4
tuberculosis and treatment for 3 months 327 6.06791352771677E-4
cutaneous lupus erythematosus 1056 0.00137674551586838
astrocytic glioma 2241 0.00138213339857396
Rheumatoid Arthritis 1171 0.00244211746536601
ependymoma 2514 0.00260642641524773
glioblastoma 5572 0.00265754133631033
osteosarcoma 7933 0.00292478917584169
primary pancreatic ductal adenocarcinoma 1271 0.00335482434702479
pancreatic cancer 2300 0.00407241628176206
head and neck cancer and chronic obstructive pulmonary disease 237 0.00436088668351131
hepatocellular carcinoma 550 0.00461738747574058
mucosa-associated lymphoid tissue lymphoma 480 0.00548443525379947
oligodendroglioma 2849 0.00858620049294414
gastric carcinoma 832 0.0138360086940421
atypical teratoid / rhabdoid tumor 4369 0.0183068276915461
acute myeloid leukemia 785 0.0208625718133979
invasive ductal carcinoma 2950 0.0244808141705478
adult high grade glioma 2148 0.0257245548463182
aldosterone-producing adenoma 664 0.0413885653560296
Disease Target Count
Huntington disease 12

Expression

  Differential Expression (39)

Synonym

Accession P11169 B2R606 D3DUU6 Q6I9U2 Q9UG15
Symbols GLUT3

Gene

PDB

4ZW9   4ZWB   4ZWC   5C65  

  Ortholog (1)

Species Source
Chimp OMA EggNOG

Gene RIF (63)

PMID Text
26639784 GLUT3 and OCT4 expression were correlated suggesting that Human embryonic stem cells self-renewal is regulated by the rate of glucose uptake.
26176916 Using lipidic cubic phase crystallization and microfocus X-ray diffraction, we determined the structure of human GLUT3 in complex with D-glucose at 1.5 A resolution in an outward-occluded conformation
25892112 The SLC2A3 duplication was the most frequent CNV detected and the only significant finding in our combined analysis , indicating that the SLC2A3 duplication might serve as a genetic modifier of congenital heart defect
25728965 We observed a strong relationship between characteristics of adaptive change to hypoxia, GLUT3 expression among birth weight-discordant twin
25578782 Glut3 is a downstream target of mTORC1, and it is critical for oncogenic mTORC1-mediated aerobic glycolysis and tumorigenesis.
25412955 Positive expression of SLC2A1, SLC2A3, and HIF-1alpha genes was noted in 83.9, 82.1, and 71.7% of SCC specimens and in 34.4, 59.4, and 62.5% of laryngeal cancer samples. Higher levels of mRNA/protein for GLUT1 and HIF-1alpha were noted in SCC compared to NCM
25306890 Leptin at concentrations used in the study does not change glucose transport into lymphocytes and seems to have no influence on the expression of GLUT1, GLUT3, GLUT4 and and leptin receptors
24813597 deletions and single-nucleotide variations involving the GLUT3 gene that may be associated with increased susceptibility to myelomeningocele (MM).
24463787 Patients after coronary artery bypass graft surgery, who have low GLUT3 levels are at increased risk for new-onset postoperative atrial fibrillation.
24452335 Data from human genetic analysis, molecular biology and a Drosophila Huntington's disease (HD) model strongly support the hypothesis that increased dosage of SLC2A3 ameliorates HD phenotypes.
More...

AA Sequence

MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFINKTLTDKGNAPPSEVLLTSLWSLSVAIF      1 - 70
SVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEMLILGRLVIGLFCGLCTGFVPM     71 - 140
YIGEISPTALRGAFGTLNQLGIVVGILVAQIFGLEFILGSEELWPLLLGFTILPAILQSAALPFCPESPR    141 - 210
FLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQ    211 - 280
QLSGINAVFYYSTGIFKDAGVQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAFCSTLMT    281 - 350
VSLLLKDNYNGMSFVCIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLF    351 - 420
PSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAK    421 - 490
ETTTNV                                                                    491 - 496
//

Text Mined References (80)

PMID Year Title
26639784 2015 GLUT3 and PKM2 regulate OCT4 expression and support the hypoxic culture of human embryonic stem cells.
26176916 2015 Molecular basis of ligand recognition and transport by glucose transporters.
25892112 2015 Copy-Number Variation of the Glucose Transporter Gene SLC2A3 and Congenital Heart Defects in the 22q11.2 Deletion Syndrome.
25728965 2015 Differential microscopic finding and glucose transporter 3 expression in terminal chorionic villi among birth weight-discordant twin placentas.
25578782 2015 NF?B up-regulation of glucose transporter 3 is essential for hyperactive mammalian target of rapamycin-induced aerobic glycolysis and tumor growth.
25412955 2015 Gene and protein expression of glucose transporter 1 and glucose transporter 3 in human laryngeal cancer-the relationship with regulatory hypoxia-inducible factor-1? expression, tumor invasiveness, and patient prognosis.
25306890 2015 Leptin at gender-specific concentrations does not affect glucose transport, expression of glucose transporters and leptin receptors in human lymphocytes.
24813597 2014 Genetic variations in the GLUT3 gene associated with myelomeningocele.
24463787 2014 Impaired myocardium energetics associated with the risk for new-onset atrial fibrillation after isolated coronary artery bypass graft surgery.
24452335 2014 Copy-number variation of the neuronal glucose transporter gene SLC2A3 and age of onset in Huntington's disease.
More...