Property Summary

NCBI Gene PubMed Count 80
PubMed Score 575.03
PubTator Score 297.42

Knowledge Summary


No data available



Accession P11168 A8K481 B2R936 B7Z547 F8W8V8 Q9UCW9
Symbols GLUT2


  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (59)

25919556 Homozygous splice-site mutation IVS8+5G>C (c.1068+5 G>C) of SLC2A2 was found in patient A and homozygous nonsense mutation c.1194T>A (p.Tyr398X) in patient B. Patient C harboured a missense mutation c.380C>A (p.Ala127Asp)
25776730 Three novel variants and seven single-nucleotide polymorphisms associated with the myelomeningocele phenotype.
25711084 SGLT1 or GLUT2 interact with the cytoskeleton in the intestinal epithelium during hexose absorption.
25687571 Data identified the last enzyme of the de novo purine synthesis pathway 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase (ATIC)and the putative tyrosine phosphatase PTPLAD1 as new regulators of Glut2(SLC2A2)translocation in HEK293 cells. SiRNA-mediated knockdown of ATIC delayed insulin response of Glut2 translocation while depletion of PTPLAD1(HACD3} strongly enhanced it in HEK293 cells.
25523092 A novel 6 nucleotide deletion in GLUT2 gene, a member of the facilitative glucose transporter family, is shown to be segregated with Fanconi-Bickel syndrome in an Iranian family.
25165176 Mutations in the GLUT2 gene is associated with ccute metabolic acidosis in Fanconi-Bickel syndrome.
24824030 GLUT-2 expression may be associated with cholangiocarcinogenesis of large bile duct and is a helpful marker for detecting high-grade biliary intraepithelial neoplasia lesions in atypical bile ducts.
24236070 SGLT1 mRNA and GLUT2 mRNA expression are reduced significantly in CACo-2 cells exposed to berry extracts.
23986439 the first gain of function mutations for hGLUT2, revealing the importance of its receptor versus transporter function in pancreatic beta cell development and insulin secretion.
23396969 Intestinal dehydroascorbic acid (DHA) transport is mediated by the facilitative sugar transporters, GLUT2 and GLUT8

AA Sequence

SFEEIAAEFQKKSGSAHRPKAAVEMKFLGATETV                                        491 - 524

Text Mined References (84)

PMID Year Title
25919556 2015 [SLC2A2 gene analysis in three Chinese children with Fanconi-Bickel syndrome].
25776730 2015 Association of facilitated glucose transporter 2 gene variants with the myelomeningocele phenotype.
25711084 2014 [The interaction between SGLT1 or GLUT2 glucose transporter and the cytoskeleton in the enterocyte as well as Caco2 cell during hexose absorption].
25687571 2015 The last enzyme of the de novo purine synthesis pathway 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase (ATIC) plays a central role in insulin signaling and the Golgi/endosomes protein network.
25523092 2015 Segregation of a novel homozygous 6 nucleotide deletion in GLUT2 gene in a Fanconi-Bickel syndrome family.
25165176 2014 Acute metabolic acidosis in a GLUT2-deficient patient with Fanconi-Bickel syndrome: new pathophysiology insights.
24824030 2014 Different expression of glucose transporters in the progression of intrahepatic cholangiocarcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24236070 2013 Regulation of glucose transporter expression in human intestinal Caco-2 cells following exposure to an anthocyanin-rich berry extract.
23986439 2013 Mutations in SLC2A2 gene reveal hGLUT2 function in pancreatic ? cell development.