Property Summary

Ligand Count 10
NCBI Gene PubMed Count 83
PubMed Score 616.56
PubTator Score 297.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0
Type 2 diabetes mellitus 272 0.0 3.0

Expression

Protein-protein Interaction (2)

Gene RIF (62)

AA Sequence

MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINSTDELPTI      1 - 70
SYSMNPKPTPWAEEETVAAAQLITMLWSLSVSSFAVGGMTASFFGGWLGDTLGRIKAMLVANILSLVGAL     71 - 140
LMGFSKLGPSHILIIAGRSISGLYCGLISGLVPMYIGEIAPTALRGALGTFHQLAIVTGILISQIIGLEF    141 - 210
ILGNYDLWHILLGLSGVRAILQSLLLFFCPESPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKER    211 - 280
EEASSEQKVSIIQLFTNSSYRQPILVALMLHVAQQFSGINGIFYYSTSIFQTAGISKPVYATIGVGAVNM    281 - 350
VFTAVSVFLVEKAGRRSLFLIGMSGMFVCAIFMSVGLVLLNKFSWMSYVSMIAIFLFVSFFEIGPGPIPW    351 - 420
FMVAEFFSQGPRPAALAIAAFSNWTCNFIVALCFQYIADFCGPYVFFLFAGVLLAFTLFTFFKVPETKGK    421 - 490
SFEEIAAEFQKKSGSAHRPKAAVEMKFLGATETV                                        491 - 524
//

Text Mined References (87)

PMID Year Title