Property Summary

NCBI Gene PubMed Count 418
Grant Count 492
R01 Count 337
Funding $53,792,334.04
PubMed Score 2531.32
PubTator Score 1866.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (58)

Disease Z-score Confidence
Cancer 2,346 5.425 2.7
Capillary hemangioma 11 4.985 2.5
diabetes mellitus 1,663 4.771 2.4
Epilepsy 346 4.729 2.4
Hyperglycemia 120 4.584 2.3
Hemangioma 35 4.407 2.2
Microcephaly 149 4.18 2.1
Hypoglycemia 81 3.788 1.9
Dystonia 77 3.745 1.9
Obesity 616 3.473 1.7
Pyruvate decarboxylase deficiency 15 3.423 1.7
Vascular disease 281 3.42 1.7
Hemiplegia 15 3.072 1.5
Metabolic syndrome X 155 3.07 1.5
Hyperinsulinism 63 3.042 1.5
Ataxia 15
Breast cancer 3,094
CHOREOATHETOSIS/SPASTICITY, EPISODIC 1
Cataract 104 4.0
Colonic Neoplasms 126
Congenital hemolytic anemia 30 4.0
Cryohydrocytosis, Stomatin-Deficient, wi... 1 
DYSTONIA 18 (disorder) 2
Degenerative polyarthritis 93
Developmental Disabilities 20
Diabetes Mellitus, Non-Insulin-Dependent 157
Ductal Carcinoma 4
EPILEPSY, IDIOPATHIC GENERALIZED, SUSCEP... 1 
GLUT1 DEFICIENCY SYNDROME 1, AUTOSOMAL R... 1 
Glut1 Deficiency Syndrome 1
Inborn Errors of Metabolism 16
Intellectual disability 573 4.0
Liver carcinoma 217
Mammary Neoplasms 410
Neoplastic Cell Transformation 81
Noninfiltrating Intraductal Carcinoma 5
Renal Cell Carcinoma 199
Seizures 95
adrenocortical carcinoma 1,427
breast carcinoma 1,614
colon cancer 1,475
ductal carcinoma in situ 1,745
group 3 medulloblastoma 2,254
interstitial cystitis 2,299
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
nervous system disorder 53
non-small cell lung cancer 2,798
osteosarcoma 7,933
ovarian cancer 8,484
ovarian neoplasm 97
pancreatic cancer 2,300
primary pancreatic ductal adenocarcinoma 1,271

Expression

Synonym

Accession P11166 A8K9S6 B2R620 D3DPX0 O75535 Q147X2
Symbols CSE
PED
DYT9
GLUT
DYT17
DYT18
EIG12
GLUT1
HTLVR
GLUT-1
SDCHCN
GLUT1DS

Gene

PDB

1SUK   4PYP   5EQG   5EQH   5EQI  

Gene RIF (378)

PMID Text
26746193 identify a downregulation of miR-150 in CD46-costimulated T cells and identify the glucose transporter 1 encoding transcript SLC2A1 as a target of miR-150 regulation
26598494 study highlights the frequency, novel mutations and clinical and molecular spectrum of PRRT2, SLC2A1 and PNKD mutations as well as the phenotype-genotype overlap among these paroxysmal movement disorders.
26573871 The underlying mechanisms were defined that the anticancer effects of apigenin were reversed by ectopic GLUT1 overexpression and galactose supplementation, through activation of pentose phosphate pathway-mediated NADPH generation
26539827 MCT1 and GLUT1 may be potential prognostic markers in adenocarcinoma.
26537434 role of mutations in absence epilepsy with early onset, but not in myoclonic astatic epilepsy
26407611 Ghrelin modulates GLUT1 expression and thus indirectly enhances tumor cell proliferation. These findings are of major relevance, because glucose uptake is assumed to be a promising target for cancer treatment.
26293674 Enhanced GLUT1 expression in melanoma cells favors their metastatic behavior.
26238658 The results suggest that the effects of apigenin on inhibiting xenograft growth and enhancing xenograft radiosensitivity may be associated with suppressing the expression of GLUT-1 via the PI3K/Akt pathway.
26193382 Patients with "classic" GLUT1DS carried all types of SLC2A1 mutations including missense, frameshift, nonsense mutations, and deletions.
26193257 These results indicate SLC2A1 exhibits a pivotal role in tumor growth, metastasis and glucose metabolism.
More...

AA Sequence

MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVHRYGESILPTTLTTLWSLSVA      1 - 70
IFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFV     71 - 140
PMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNKDLWPLLLSIIFIPALLQCIVLPFCPES    141 - 210
PRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQL    211 - 280
SQQLSGINAVFYYSTSIFEKAGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAIL    281 - 350
MTIALALLEQLPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM    351 - 420
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADS    421 - 490
QV                                                                        491 - 492
//

Text Mined References (433)

PMID Year Title
26746193 2016 CD46 Activation Regulates miR-150-Mediated Control of GLUT1 Expression and Cytokine Secretion in Human CD4+ T Cells.
26598494 2015 The clinical and genetic heterogeneity of paroxysmal dyskinesias.
26573871 2016 Inhibition of glutamine utilization sensitizes lung cancer cells to apigenin-induced apoptosis resulting from metabolic and oxidative stress.
26539827 2015 A Pilot Proteogenomic Study with Data Integration Identifies MCT1 and GLUT1 as Prognostic Markers in Lung Adenocarcinoma.
26537434 2015 The role of SLC2A1 mutations in myoclonic astatic epilepsy and absence epilepsy, and the estimated frequency of GLUT1 deficiency syndrome.
26407611 2016 Ghrelin promotes oral tumor cell proliferation by modifying GLUT1 expression.
26293674 2015 Glucose transporter isoform 1 expression enhances metastasis of malignant melanoma cells.
26238658 2015 Inhibiting GLUT-1 expression and PI3K/Akt signaling using apigenin improves the radiosensitivity of laryngeal carcinoma in vivo.
26193382 2015 From splitting GLUT1 deficiency syndromes to overlapping phenotypes.
26193257 2015 Deregulated SLC2A1 Promotes Tumor Cell Proliferation and Metastasis in Gastric Cancer.
More...