Property Summary

Ligand Count 48
NCBI Gene PubMed Count 478
PubMed Score 2703.29
PubTator Score 1866.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Dystonia 164 3.778 1.9
Congenital hemolytic anemia 32 0.0 4.0

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 1.700 2.3e-05
adrenocortical carcinoma 1.313 8.2e-03
Breast cancer 2.700 3.0e-02
breast carcinoma 1.500 1.1e-03
colon cancer 1.300 2.5e-02
ductal carcinoma in situ 1.300 6.7e-04
group 3 medulloblastoma -1.100 5.2e-03
interstitial cystitis -1.200 2.8e-03
intraductal papillary-mucinous carcinoma... 2.500 2.9e-04
intraductal papillary-mucinous neoplasm ... 1.800 1.2e-03
invasive ductal carcinoma 1.300 4.6e-03
lung adenocarcinoma 1.500 8.8e-09
lung cancer 2.100 3.1e-04
lung carcinoma 1.100 1.3e-12
non-small cell lung cancer 1.302 2.5e-10
osteosarcoma -2.736 1.1e-05
ovarian cancer 2.500 2.9e-10
pancreatic cancer 2.300 9.7e-09
primary pancreatic ductal adenocarcinoma 1.488 4.4e-02

Protein-protein Interaction (4)

Gene RIF (436)

AA Sequence

MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVHRYGESILPTTLTTLWSLSVA      1 - 70
IFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFV     71 - 140
PMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNKDLWPLLLSIIFIPALLQCIVLPFCPES    141 - 210
PRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQL    211 - 280
SQQLSGINAVFYYSTSIFEKAGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAIL    281 - 350
MTIALALLEQLPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM    351 - 420
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADS    421 - 490
QV                                                                        491 - 492
//

Text Mined References (493)

PMID Year Title