Property Summary

NCBI Gene PubMed Count 89
PubMed Score 341.86
PubTator Score 166.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count P-value
inflammatory breast cancer 286 6.0e-09
lung carcinoma 2843 1.8e-08
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Bone cancer 16 0.0 3.0
Rheumatoid arthritis 1191 0.0 1.2
Disease Target Count Z-score Confidence
Polyneuropathy 64 3.117 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
inflammatory breast cancer -3.400 6.0e-09
lung carcinoma -1.700 1.8e-08

Gene RIF (64)

AA Sequence

MMTAKAVDKIPVTLSGFVHQLSDNIYPVEDLAATSVTIFPNAELGGPFDQMNGVAGDGMINIDMTGEKRS      1 - 70
LDLPYPSSFAPVSAPRNQTFTYMGKFSIDPQYPGASCYPEGIINIVSAGILQGVTSPASTTASSSVTSAS     71 - 140
PNPLATGPLGVCTMSQTQPDLDHLYSPPPPPPPYSGCAGDLYQDPSAFLSAATTSTSSSLAYPPPPSYPS    141 - 210
PKPATDPGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGV    211 - 280
TGPGASGGSEGPRLPGSSSAAAAAAAAAAYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRR    281 - 350
FSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIH    351 - 420
LRQKERKSSAPSASVPAPSTASCSGGVQPGGTLCSSNSSSLGGGPLAPCSSRTRTP                  421 - 476
//

Text Mined References (88)

PMID Year Title