Property Summary

NCBI Gene PubMed Count 83
Grant Count 120
R01 Count 86
Funding $12,454,557.57
PubMed Score 317.50
PubTator Score 166.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
non-inflammatory breast cancer -3.500 0.000
lung carcinoma -1.700 0.000

Synonym

Accession P11161 B2R724 B3KRD7 Q68CZ5 Q8IV26 Q9UNA6
Symbols AT591
CMT1D
CMT4E
KROX20

Gene

 GO Component (2)

 GWAS Trait (2)

Gene RIF (58)

PMID Text
26718337 These results suggested that EGR2 overexpression has a pivotal role in the downregulation of cytokines implicated in the pathophysiology of Guillain-Barre syndrome
26238942 MicroRNA20a promotes the proliferation and cell cycle of human osteosarcoma cells by suppressing EGR2 expression.
26214589 EGR2 knockdown inhibited proliferation, clonogenicity and spheroidal growth in vitro and induced regression of Ewing sarcoma xenografts.
26204789 EGR2 mutation presents as an axonal Charcot-Marie-Tooth phenotype with variable severity.
26119399 A recurrent mutation was identified in EGR2 which appears to be associated with the pathogenesis of schizophrenia.
25935837 Knock-down of EGR2 with siRNA was demonstrated to have a similar effect as the over-expression of miR-330-3p in NSCLC cell lines
25613138 The gene expression of early growth response 2 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25548232 our data suggest that robust CD26 costimulatory signaling induces preferential expression of EGR2 and IL-10 as a potential mechanism for regulating CD26-mediated activation.
25381473 Dysregulated Egr-2 is observed in some human autoimmune disorders.
24007274 transcription factor early growth response gene-2 is a novel molecular switch regulating known immunomodulatory molecules in human mesenchymal stem cells.
More...

AA Sequence

MMTAKAVDKIPVTLSGFVHQLSDNIYPVEDLAATSVTIFPNAELGGPFDQMNGVAGDGMINIDMTGEKRS      1 - 70
LDLPYPSSFAPVSAPRNQTFTYMGKFSIDPQYPGASCYPEGIINIVSAGILQGVTSPASTTASSSVTSAS     71 - 140
PNPLATGPLGVCTMSQTQPDLDHLYSPPPPPPPYSGCAGDLYQDPSAFLSAATTSTSSSLAYPPPPSYPS    141 - 210
PKPATDPGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGV    211 - 280
TGPGASGGSEGPRLPGSSSAAAAAAAAAAYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRR    281 - 350
FSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIH    351 - 420
LRQKERKSSAPSASVPAPSTASCSGGVQPGGTLCSSNSSSLGGGPLAPCSSRTRTP                  421 - 476
//

Text Mined References (82)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26718337 2016 Expression of Early Growth Response Gene-2 and Regulated Cytokines Correlates with Recovery from Guillain-Barré Syndrome.
26238942 2015 MicroRNA?20a promotes the proliferation and cell cycle of human osteosarcoma cells by suppressing early growth response 2 expression.
26214589 2015 Chimeric EWSR1-FLI1 regulates the Ewing sarcoma susceptibility gene EGR2 via a GGAA microsatellite.
26204789 2015 The EGR2 gene is involved in axonal Charcot-Marie-Tooth disease.
26119399 2015 Resequencing of early growth response 2 (EGR2) gene revealed a recurrent patient-specific mutation in schizophrenia.
25935837 2015 miR-330-3p controls cell proliferation by targeting early growth response 2 in non-small-cell lung cancer.
25548232 2015 CD26-mediated induction of EGR2 and IL-10 as potential regulatory mechanism for CD26 costimulatory pathway.
25381473 2015 The roles of Egr-2 in autoimmune diseases.
25108386 2014 Genome-wide association analysis of Vogt-Koyanagi-Harada syndrome identifies two new susceptibility loci at 1p31.2 and 10q21.3.
More...