Property Summary

Ligand Count 281
NCBI Gene PubMed Count 307
PubMed Score 388.96
PubTator Score 759.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Age related macular degeneration 72 4.237 2.1

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.600 7.4e-07
glioblastoma -1.300 4.6e-04
group 3 medulloblastoma -1.200 9.5e-03
medulloblastoma, large-cell -1.600 3.7e-03
pancreatic ductal adenocarcinoma liver m... -2.492 3.7e-03
primitive neuroectodermal tumor -1.600 4.4e-04

Protein-protein Interaction (2)

Gene RIF (314)

AA Sequence

MDTSPLCFSILLVLCIFIQSSALGQSLKPEPFGRRAQAVETNKTLHEMKTRFLLFGETNQGCQIRINHPD      1 - 70
TLQECGFNSSLPLVMIIHGWSVDGVLENWIWQMVAALKSQPAQPVNVGLVDWITLAHDHYTIAVRNTRLV     71 - 140
GKEVAALLRWLEESVQLSRSHVHLIGYSLGAHVSGFAGSSIGGTHKIGRITGLDAAGPLFEGSAPSNRLS    141 - 210
PDDANFVDAIHTFTREHMGLSVGIKQPIGHYDFYPNGGSFQPGCHFLELYRHIAQHGFNAITQTIKCSHE    211 - 280
RSVHLFIDSLLHAGTQSMAYPCGDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSKRLFLVTRAQSPFK    281 - 350
VYHYQFKIQFINQTETPIQTTFTMSLLGTKEKMQKIPITLGKGIASNKTYSFLITLDVDIGELIMIKFKW    351 - 420
ENSAVWANVWDTVQTIIPWSTGPRHSGLVLKTIRVKAGETQQRMTFCSENTDDLLLRPTQEKIFVKCEIK    421 - 490
SKTSKRKIR                                                                 491 - 499
//

Text Mined References (311)

PMID Year Title