Property Summary

NCBI Gene PubMed Count 302
Grant Count 49
R01 Count 27
Funding $7,877,688.81
PubMed Score 388.38
PubTator Score 759.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (309)

PMID Text
26503844 The hepatic lipase (LIPC) rs10468017 variant was associated with a significantly decreased risk of AMD
26282880 the association between LIPC C-514T polymorphism, obesity and plasma lipid profile in Chinese children and adolescents, is reported.
26193433 results show that SM is a physiological inhibitor of HL activity in lipoproteins and that the specificity of the enzyme towards HDL is at least partly due to its low SM content.
26101956 polymorphisms in HL protect HIV-infected patients from developing atherogenic dyslipidemia in a dose-dependent manner
25926410 Dietary fat intake significantly modified the LIPC genetic effect on changes in serum triglyceride, LDL cholesterol, and HDL cholesterol concentrations during a 2-y randomized weight-loss intervention trial.
25550127 Hepatic lipase C-514T gene polymorphism is associated with cardiometabolic parameters and cardiovascular risk factors but not with fatty liver
25239670 The role of hepatic triglyceride lipase in remnant lipoprotein metabolism.
25117371 there was no strong evidence to support an association between LIPC and HDCP in Han Chinese women. However, LIPC variants were associated with BMI, SBP, and lipid profiles in patients.
25010633 Our meta-analysis indicates that LIPC rs10468017 variant is associated with a reduced risk of advanced age-related macular degeneration.
24458708 HL activity, as TG-hydrolase, was increased in metabolic syndrome and obesity; directly correlated with low-density lipoprotein-cholesterol and apolipoprotein B and negatively with high-density lipoprotein-cholesterol in controls.
More...

AA Sequence

MDTSPLCFSILLVLCIFIQSSALGQSLKPEPFGRRAQAVETNKTLHEMKTRFLLFGETNQGCQIRINHPD      1 - 70
TLQECGFNSSLPLVMIIHGWSVDGVLENWIWQMVAALKSQPAQPVNVGLVDWITLAHDHYTIAVRNTRLV     71 - 140
GKEVAALLRWLEESVQLSRSHVHLIGYSLGAHVSGFAGSSIGGTHKIGRITGLDAAGPLFEGSAPSNRLS    141 - 210
PDDANFVDAIHTFTREHMGLSVGIKQPIGHYDFYPNGGSFQPGCHFLELYRHIAQHGFNAITQTIKCSHE    211 - 280
RSVHLFIDSLLHAGTQSMAYPCGDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSKRLFLVTRAQSPFK    281 - 350
VYHYQFKIQFINQTETPIQTTFTMSLLGTKEKMQKIPITLGKGIASNKTYSFLITLDVDIGELIMIKFKW    351 - 420
ENSAVWANVWDTVQTIIPWSTGPRHSGLVLKTIRVKAGETQQRMTFCSENTDDLLLRPTQEKIFVKCEIK    421 - 490
SKTSKRKIR                                                                 491 - 499
//

Text Mined References (306)

PMID Year Title
26503844 2015 CETP/LPL/LIPC gene polymorphisms and susceptibility to age-related macular degeneration.
26282880 2015 Gender specific effect of LIPC C-514T polymorphism on obesity and relationship with plasma lipid levels in Chinese children.
26193433 2015 Regulation of hepatic lipase activity by sphingomyelin in plasma lipoproteins.
26101956 2015 Polymorphisms in LPL, CETP, and HL protect HIV-infected patients from atherogenic dyslipidemia in an allele-dose-dependent manner.
25926410 2015 Dietary Fat Intake Modifies the Effect of a Common Variant in the LIPC Gene on Changes in Serum Lipid Concentrations during a Long-Term Weight-Loss Intervention Trial.
25550127 2015 Hepatic lipase (LIPC) C-514T gene polymorphism is associated with cardiometabolic parameters and cardiovascular risk factors but not with fatty liver in Mexican population.
25239670 2015 Comparison of the effect of post-heparin and pre-heparin lipoprotein lipase and hepatic triglyceride lipase on remnant lipoprotein metabolism.
25117371 2014 Variants -250G/A and -514C/T in the LIPC gene are associated with hypertensive disorders of pregnancy in Chinese women.
25010633 2014 The relationship between hepatic lipase gene variant and advanced age-related macular degeneration: a meta-analysis.
24816252 2014 An atlas of genetic influences on human blood metabolites.
More...