Property Summary

NCBI Gene PubMed Count 249
Grant Count 285
R01 Count 213
Funding $31,393,998.97
PubMed Score 856.02
PubTator Score 604.06

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P11142 Q9H3R6
Symbols LAP1
HSC54
HSC70
HSC71
HSP71
HSP73
LAP-1
NIP71
HEL-33
HSPA10
HEL-S-72p

Gene

PANTHER Protein Class (2)

PDB

3FZF   3FZH   3FZK   3FZL   3FZM   3LDQ   3M3Z   3ESK   4KBQ   3AGY   3AGZ   4H5N   4H5R   4H5T   4H5V   4H5W   4HWI  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
568 confirmatory 2 / 0 / 82557 High Throughput Screening Assay for Hsc70 Inhibitors
1193 confirmatory 21 / 0 / 32 In Vitro Hsc70 Dose Response Fluorescence Polarization Assay

Gene RIF (137)

PMID Text
26775844 These findings provide further evidence that histatin 3 may be involved in the regulation of cell proliferation, particularly during G1/S transition, via the ubiquitin-proteasome system of p27(Kip1) and HSC70.
26596547 LAP1 mutations are associated with severe dystonia, cerebellar atrophy and cardiomyopathy.
26549849 HSPA8 maintains pluripotency of human pluripotent stem cells by binding to the master pluripotency regulator OCT4 and facilitating its DNA-binding activity.
26481195 Cx43-Hsc70 interaction regulates cell cycle G1/S progression through a novel mechanism by which Cx43-Hsc70 interaction prevents the nuclear accumulation of p27 through controlling the nuclear translocation of cyclin D1-CDK4-p27 complex.
26425554 serum HSC71 was identified as a novel serum biomarker of renal cell carcinoma, particularly useful in early diagnosis of clear-cell type.
26335814 constitutive heat shock protein HSC70 forms granule-like structures in the cytoplasm of human cells several days after the exposure to heat stress
26232501 These results indicate that CHIP decreases the Kv1.5 protein level and functional channel by facilitating its degradation in concert with chaperone Hsc70
26229111 heat shock cognate 70 (HSC70) is an essential component of Aes foci in colorectal cancer cells.
26010904 detailed and systematic investigation to characterize if there are significant differences in the CHIP in vitro ubiquitination of human Hsp70 and Hsc70.
25953005 HSC70 may serve as a molecular switch to modulate endocytic and autophagy pathways, impacting the source of antigens delivered for MHC class II presentation during cellular stress. (Review)
More...

AA Sequence

MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDA      1 - 70
KRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVT     71 - 140
NAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSIL    141 - 210
TIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQA    211 - 280
SIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLL    281 - 350
QDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI    351 - 420
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA    421 - 490
VDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQG    491 - 560
KINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGA    561 - 630
PPSGGASSGPTIEEVD                                                          631 - 646
//

Text Mined References (275)

PMID Year Title
27346687 2016 DNAJC21 Mutations Link a Cancer-Prone Bone Marrow Failure Syndrome to Corruption in 60S Ribosome Subunit Maturation.
26775844 2016 Salivary protein histatin 3 regulates cell proliferation by enhancing p27(Kip1) and heat shock cognate protein 70 ubiquitination.
26596547 Genetic mutations strengthen functional association of LAP1 with DYT1 dystonia and muscular dystrophy.
26549849 2015 A Chemical Biology Study of Human Pluripotent Stem Cells Unveils HSPA8 as a Key Regulator of Pluripotency.
26481195 2015 Interaction of Cx43 with Hsc70 regulates G1/S transition through CDK inhibitor p27.
26425554 2015 iTRAQ-Based Quantitative Proteomic Analysis Identified HSC71 as a Novel Serum Biomarker for Renal Cell Carcinoma.
26335814 2015 Heat stress induces formation of cytoplasmic granules containing HSC70 protein.
26232501 2015 E3 ligase CHIP and Hsc70 regulate Kv1.5 protein expression and function in mammalian cells.
26229111 2016 Characterization of Aes nuclear foci in colorectal cancer cells.
26212789 2015 Chaperone-mediated autophagy prevents apoptosis by degrading BBC3/PUMA.
More...