Property Summary

NCBI Gene PubMed Count 76
Grant Count 141
R01 Count 79
Funding $22,760,713.23
PubMed Score 1083.71
PubTator Score 918.40

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P11137 Q17S04 Q8IUX2 Q99975 Q99976 MAP-2
Symbols MAP2A
MAP2B
MAP2C

Gene

Gene RIF (56)

PMID Text
26604067 Study reveals the presence of two selected neuronal markers, MAP-2 and SYP mRNAs and protein expression, in eutopic endometrium and in endometriotic lesions.
26134402 the difference of only two amino acids in tau and MAP2 sequences may determine their different fates in tauopathies
26014048 Transcriptional upregulation of microtubule-associated protein 2 is involved in the protein kinase A-induced decrease in the invasiveness of glioma cells.
25871823 This is the first report to analyze the correlation between ET-1-induced miRNA 133a overexpression in proteinuria resulting in MRP2 downregulation, which is a contributing factor for renal cytotoxicity.
25818630 Findings demonstrate that microtubule-associated protein 2-immunoreactivity loss is closely linked to dendritic spine pathology in schizophrenia.
25682157 MAP2 expression is affected by actomyosin contractility during nanotopography-directed neuronal differentiation of human embryonic stem cells
25653352 HIV-1 Tat co-localizes with microtubule-associated protein 2 in neuronal cells
25629269 Prolactin significantly increased the gene expression and protein levels of MAP2 in SK-N-SH neuroblastoma cells, while no significant changes were observed in U-87MG glioblastoma cells.
25569473 MAP2 expression in ovarian teratomas does not appear to have a role in predictive the development of anti-NMDAR encephalitis.
25497017 PP2A/striatin complex modulates microtubule dynamics by regulating MAP2 phosphorylation
More...

AA Sequence

MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNT      1 - 70
KENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQTAALPLAAEETANLPPSPPPS     71 - 140
PASEQTVTVEEDLLTASKMEFHDQQELTPSTAEPSDQKEKESEKQSKPGEDLKHAALVSQPETTKTYPDK    141 - 210
KDMQGTEEEKAPLALFGHTLVASLEDMKQKTEPSLVVPGIDLPKEPPTPKEQKDWFIEMPTEAKKDEWGL    211 - 280
VAPISPGPLTPMREKDVFDDIPKWEGKQFDSPMPSPFQGGSFTLPLDVMKNEIVTETSPFAPAFLQPDDK    281 - 350
KSLQQTSGPATAKDSFKIEEPHEAKPDKMAEAPPSEAMTLPKDAHIPVVEEHVMGKVLEEEKEAINQETV    351 - 420
QQRDTFTPSGQEPILTEKETELKLEEKTTISDKEAVPKESKPPKPADEEIGIIQTSTEHTFSEQKDQEPT    421 - 490
TDMLKQDSFPVSLEQAVTDSAMTSKTLEKAMTEPSALIEKSSIQELFEMRVDDKDKIEGVGAATSAELDM    491 - 560
PFYEDKSGMSKYFETSALKEEATKSIEPGSDYYELSDTRESVHESIDTMSPMHKNGDKEFQTGKESQPSP    561 - 630
PAQEAGYSTLAQSYPSDLPEEPSSPQERMFTIDPKVYGEKRDLHSKNKDDLTLSRSLGLGGRSAIEQRSM    631 - 700
SINLPMSCLDSIALGFNFGRGHDLSPLASDILTNTSGSMDEGDDYLPATTPALEKAPCFPVESKEEEQIE    701 - 770
KVKATGEESTQAEISCESPFLAKDFYKNGTVMAPDLPEMLDLAGTRSRLASVSADAEVARRKSVPSETVV    771 - 840
EDSRTGLPPVTDENHVIVKTDSQLEDLGYCVFNKYTVPLPSPVQDSENLSGESGTFYEGTDDKVRRDLAT    841 - 910
DLSLIEVKLAAAGRVKDEFSVDKEASAHISGDKSGLSKEFDQEKKANDRLDTVLEKSEEHADSKEHAKKT    911 - 980
EEAGDEIETFGLGVTYEQALAKDLSIPTDASSEKAEKGLSSVPEIAEVEPSKKVEQGLDFAVQGQLDVKI    981 - 1050
SDFGQMASGLNIDDRRATELKLEATQDMTPSSKAPQEADAFMGVESGHMKEGTKVSETEVKEKVAKPDLV   1051 - 1120
HQEAVDKEESYESSGEHESLTMESLKADEGKKETSPESSLIQDEIAVKLSVEIPCPPAVSEADLATDERA   1121 - 1190
DVQMEFIQGPKEESKETPDISITPSDVAEPLHETIVSEPAEIQSEEEEIEAQGEYDKLLFRSDTLQITDL   1191 - 1260
GVSGAREEFVETCPSEHKGVIESVVTIEDDFITVVQTTTDEGESGSHSVRFAALEQPEVERRPSPHDEEE   1261 - 1330
FEVEEAAEAQAEPKDGSPEAPASPEREEVALSEYKTETYDDYKDETTIDDSIMDADSLWVDTQDDDRSIM   1331 - 1400
TEQLETIPKEEKAEKEARRSSLEKHRKEKPFKTGRGRISTPERKVAKKEPSTVSRDEVRRKKAVYKKAEL   1401 - 1470
AKKTEVQAHSPSRKFILKPAIKYTRPTHLSCVKRKTTAAGGESALAPSVFKQAKDKVSDGVTKSPEKRSS   1471 - 1540
LPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYS   1541 - 1610
SRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGST   1611 - 1680
DNIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVP   1681 - 1750
GGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTA   1751 - 1820
ALAKQGL                                                                  1821 - 1827
//

Text Mined References (82)

PMID Year Title
26604067 2016 Expression of microtubule associated protein 2 and synaptophysin in endometrium: high levels in deep infiltrating endometriosis lesions.
26134402 2015 Identification of key amino acids responsible for the distinct aggregation properties of microtubule-associated protein 2 and tau.
26014048 2015 Transcriptional upregulation of microtubule-associated protein 2 is involved in the protein kinase A-induced decrease in the invasiveness of glioma cells.
25871823 2015 ET-1 Induced Downregulation of MRP2 via miRNA 133a - A Marker for Tubular Nephrotoxicity?
25818630 2015 Loss of Microtubule-Associated Protein 2 Immunoreactivity Linked to Dendritic Spine Loss in Schizophrenia.
25682157 2015 Actomyosin contractility plays a role in MAP2 expression during nanotopography-directed neuronal differentiation of human embryonic stem cells.
25629269 2014 Prolactin increases expression of cytoskeletal proteins in SK-N-SH cells.
25569473 Does MAP2 have a role in predicting the development of anti-NMDAR encephalitis associated with benign ovarian teratoma? A report of six new pediatric cases.
25497017 2015 Downregulation of striatin leads to hyperphosphorylation of MAP2, induces depolymerization of microtubules and inhibits proliferation of HEK293T cells.
25400739 2014 Expression of SNCG, MAP2, SDF-1 and CXCR4 in gastric adenocarcinoma and their clinical significance.
More...