Property Summary

Ligand Count 47
NCBI Gene PubMed Count 79
PubMed Score 1110.60
PubTator Score 918.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Abortion, Spontaneous 109 0.0 0.0
Arthritis, Juvenile 126 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.4
Kidney cancer 2613 0.0 1.0
Liver cancer 604 0.0 0.5
Disease Target Count Z-score Confidence
Age related macular degeneration 72 0.0 5.0

Expression

  Differential Expression (22)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 1.6e-02
Breast cancer -2.300 6.9e-07
breast carcinoma -1.300 1.2e-25
chronic lymphosyte leukemia 1.700 7.9e-04
ependymoma -1.300 3.2e-07
glioblastoma -1.600 1.1e-02
head and neck cancer -1.200 4.6e-02
interstitial lung disease -1.300 2.0e-02
intraductal papillary-mucinous adenoma (... -1.800 2.9e-03
intraductal papillary-mucinous carcinoma... -2.900 3.5e-04
intraductal papillary-mucinous neoplasm ... -1.800 3.9e-02
lung adenocarcinoma -1.200 1.9e-08
malignant mesothelioma -6.000 6.9e-10
medulloblastoma, large-cell -1.800 8.7e-04
non-small cell lung cancer -1.617 2.5e-08
oligodendroglioma 1.800 8.7e-03
ovarian cancer -2.000 7.8e-04
pediatric high grade glioma -1.100 1.8e-02
periodontitis -1.400 6.8e-27
Pick disease -1.700 7.2e-04
pituitary cancer 1.100 1.6e-05
spina bifida -1.659 3.8e-03

Gene RIF (58)

AA Sequence

MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNT      1 - 70
KENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQTAALPLAAEETANLPPSPPPS     71 - 140
PASEQTVTVEEDLLTASKMEFHDQQELTPSTAEPSDQKEKESEKQSKPGEDLKHAALVSQPETTKTYPDK    141 - 210
KDMQGTEEEKAPLALFGHTLVASLEDMKQKTEPSLVVPGIDLPKEPPTPKEQKDWFIEMPTEAKKDEWGL    211 - 280
VAPISPGPLTPMREKDVFDDIPKWEGKQFDSPMPSPFQGGSFTLPLDVMKNEIVTETSPFAPAFLQPDDK    281 - 350
KSLQQTSGPATAKDSFKIEEPHEAKPDKMAEAPPSEAMTLPKDAHIPVVEEHVMGKVLEEEKEAINQETV    351 - 420
QQRDTFTPSGQEPILTEKETELKLEEKTTISDKEAVPKESKPPKPADEEIGIIQTSTEHTFSEQKDQEPT    421 - 490
TDMLKQDSFPVSLEQAVTDSAMTSKTLEKAMTEPSALIEKSSIQELFEMRVDDKDKIEGVGAATSAELDM    491 - 560
PFYEDKSGMSKYFETSALKEEATKSIEPGSDYYELSDTRESVHESIDTMSPMHKNGDKEFQTGKESQPSP    561 - 630
PAQEAGYSTLAQSYPSDLPEEPSSPQERMFTIDPKVYGEKRDLHSKNKDDLTLSRSLGLGGRSAIEQRSM    631 - 700
SINLPMSCLDSIALGFNFGRGHDLSPLASDILTNTSGSMDEGDDYLPATTPALEKAPCFPVESKEEEQIE    701 - 770
KVKATGEESTQAEISCESPFLAKDFYKNGTVMAPDLPEMLDLAGTRSRLASVSADAEVARRKSVPSETVV    771 - 840
EDSRTGLPPVTDENHVIVKTDSQLEDLGYCVFNKYTVPLPSPVQDSENLSGESGTFYEGTDDKVRRDLAT    841 - 910
DLSLIEVKLAAAGRVKDEFSVDKEASAHISGDKSGLSKEFDQEKKANDRLDTVLEKSEEHADSKEHAKKT    911 - 980
EEAGDEIETFGLGVTYEQALAKDLSIPTDASSEKAEKGLSSVPEIAEVEPSKKVEQGLDFAVQGQLDVKI    981 - 1050
SDFGQMASGLNIDDRRATELKLEATQDMTPSSKAPQEADAFMGVESGHMKEGTKVSETEVKEKVAKPDLV   1051 - 1120
HQEAVDKEESYESSGEHESLTMESLKADEGKKETSPESSLIQDEIAVKLSVEIPCPPAVSEADLATDERA   1121 - 1190
DVQMEFIQGPKEESKETPDISITPSDVAEPLHETIVSEPAEIQSEEEEIEAQGEYDKLLFRSDTLQITDL   1191 - 1260
GVSGAREEFVETCPSEHKGVIESVVTIEDDFITVVQTTTDEGESGSHSVRFAALEQPEVERRPSPHDEEE   1261 - 1330
FEVEEAAEAQAEPKDGSPEAPASPEREEVALSEYKTETYDDYKDETTIDDSIMDADSLWVDTQDDDRSIM   1331 - 1400
TEQLETIPKEEKAEKEARRSSLEKHRKEKPFKTGRGRISTPERKVAKKEPSTVSRDEVRRKKAVYKKAEL   1401 - 1470
AKKTEVQAHSPSRKFILKPAIKYTRPTHLSCVKRKTTAAGGESALAPSVFKQAKDKVSDGVTKSPEKRSS   1471 - 1540
LPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYS   1541 - 1610
SRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGST   1611 - 1680
DNIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVP   1681 - 1750
GGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTA   1751 - 1820
ALAKQGL                                                                  1821 - 1827
//

Text Mined References (85)

PMID Year Title