Property Summary

NCBI Gene PubMed Count 33
PubMed Score 237.01
PubTator Score 37.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.300 1.5e-02
malignant mesothelioma -1.300 2.4e-06
non primary Sjogren syndrome sicca 1.100 3.4e-02
ovarian cancer 1.300 1.6e-04

 GO Function (1)

Gene RIF (6)

AA Sequence

MAGKRSGWSRAALLQLLLGVNLVVMPPTRARSLRFVTLLYRHGDRSPVKTYPKDPYQEEEWPQGFGQLTK      1 - 70
EGMLQHWELGQALRQRYHGFLNTSYHRQEVYVRSTDFDRTLMSAEANLAGLFPPNGMQRFNPNISWQPIP     71 - 140
VHTVPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANETGLTDLTLETVWNVYDTL    141 - 210
FCEQTHGLRLPPWASPQTMQRLSRLKDFSFRFLFGIYQQAEKARLQGGVLLAQIRKNLTLMATTSQLPKL    211 - 280
LVYSAHDTTLVALQMALDVYNGEQAPYASCHIFELYQEDSGNFSVEMYFRNESDKAPWPLSLPGCPHRCP    281 - 350
LQDFLRLTEPVVPKDWQQECQLASGPADTEVIVALAVCGSILFLLIVLLLTVLFRMQAQPPGYRHVADGE    351 - 420
DHA                                                                       421 - 423
//

Text Mined References (37)

PMID Year Title