Property Summary

NCBI Gene PubMed Count 43
Grant Count 60
R01 Count 39
Funding $10,098,189.38
PubMed Score 840.37
PubTator Score 313.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 2.300 0.000
lung cancer 1.400 0.001
adult high grade glioma -1.100 0.000
aldosterone-producing adenoma -1.427 0.028
lung adenocarcinoma -2.900 0.000
psoriasis -1.500 0.000

Synonym

Accession P11086 PNMTase
Symbols PENT
PNMTase

Gene

PANTHER Protein Class (2)

PDB

1HNN   1N7I   1N7J   1YZ3   2AN3   2AN4   2AN5   2G70   2G71   2G72   2G8N   2OBF   2ONY   2ONZ   2OPB   3HCA   3HCB   3HCC   3HCD   3HCE   3HCF   3KPJ   3KPU   3KPV   3KPW   3KPY   3KQM   3KQO   3KQP   3KQQ   3KQS   3KQT   3KQV   3KQW   3KQY   3KR0   3KR1   3KR2   4DM3   4MIK   4MQ4  

Gene RIF (40)

PMID Text
24018397 initial velocity studies on human PNMT in the absence and presence of product and dead end inhibitors.
21866188 The 2-SNP AA haplotype in the PNMT promoter is associated with decreased risk of essential hypertension in Han Chinese.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20204374 PNMT variants in cis may interact with nuclear factors in trans to govern adrenergic activity.
20090367 In Caucasians, phenylethanolamine N-methyltransferase single nucleotide polymorphisms are associated with the development of acute kidney injury, disease severity, and in-hospital mortality.
20090367 Observational study of gene-disease association. (HuGE Navigator)
19952402 PNMT G-390A polymorphism is possibly associated with essential hypertension risk in male Chinese Han population.
19952402 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEV      1 - 70
SGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECW     71 - 140
QDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGH    141 - 210
LLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV    211 - 280
GL                                                                        281 - 282
//

Text Mined References (48)

PMID Year Title
24018397 2013 Kinetic and pH studies on human phenylethanolamine N-methyltransferase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21866188 2011 Phenylethanolamine N-methyltransferase gene promoter haplotypes and risk of essential hypertension.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20504532 1989 Structure of human phenylethanolamine n-methyltransferase gene: existence of two types of mRNA with different transcription initiation sites.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20204374 2010 Conserved regulatory motifs at phenylethanolamine N-methyltransferase (PNMT) are disrupted by common functional genetic variation: an integrated computational/experimental approach.
20090367 2010 Phenylethanolamine N-methyltransferase gene polymorphisms and adverse outcomes in acute kidney injury.
19952402 2009 [Association of genetic polymorphism in phenylethanolamine-N-methyl transferase with essential hypertension in Changsha Han people].
More...