Property Summary

Ligand Count 72
NCBI Gene PubMed Count 44
PubMed Score 857.60
PubTator Score 313.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.100 2.0e-04
aldosterone-producing adenoma -1.427 2.8e-02
lung adenocarcinoma -2.900 7.6e-19
lung cancer 1.400 9.2e-04
malignant mesothelioma 2.300 1.7e-07
psoriasis -1.500 1.1e-14

Synonym

Accession P11086 PNMTase
Symbols PENT
PNMTase

Gene

PANTHER Protein Class (2)

PDB

1HNN   1N7I   1N7J   1YZ3   2AN3   2AN4   2AN5   2G70   2G71   2G72   2G8N   2OBF   2ONY   2ONZ   2OPB   3HCA   3HCB   3HCC   3HCD   3HCE   3HCF   3KPJ   3KPU   3KPV   3KPW   3KPY   3KQM   3KQO   3KQP   3KQQ   3KQS   3KQT   3KQV   3KQW   3KQY   3KR0   3KR1   3KR2   4DM3   4MIK   4MQ4  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (41)

AA Sequence

MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEV      1 - 70
SGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECW     71 - 140
QDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGH    141 - 210
LLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV    211 - 280
GL                                                                        281 - 282
//

Text Mined References (49)

PMID Year Title