Property Summary

NCBI Gene PubMed Count 28
PubMed Score 89.62
PubTator Score 63.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma 1.400 1.0e-02
astrocytoma 1.800 1.1e-02
Astrocytoma, Pilocytic 1.600 1.8e-05
COPD -1.200 1.4e-03
cutaneous lupus erythematosus 2.400 1.7e-03
ductal carcinoma in situ 1.500 2.3e-02
glioblastoma 1.800 7.6e-03
interstitial cystitis 2.700 3.9e-03
invasive ductal carcinoma 1.472 1.9e-03
lung carcinoma -2.400 1.6e-28
non-small cell lung cancer -1.847 3.7e-14
osteosarcoma -3.510 1.8e-04
psoriasis -1.200 5.9e-03
Rheumatoid arthritis -2.700 3.3e-03
spina bifida 1.517 4.8e-02
subependymal giant cell astrocytoma 1.556 2.8e-02
ulcerative colitis 2.500 8.9e-04

Synonym

Accession P11049 B4DVC1 Q3KPF9
Symbols GP52-40
TSPAN26

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (13)

AA Sequence

MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLAFVPLQIWSKVLAISGIFTMG      1 - 70
IALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRAQLERSLRDVVEKTIQKYGTNPEETAAE     71 - 140
ESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARS    141 - 210
RHSADICAVPAESHIYREGCAQGLQKWLHNNLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARY    211 - 280
R//

Text Mined References (30)

PMID Year Title