Property Summary

NCBI Gene PubMed Count 27
PubMed Score 88.75
PubTator Score 63.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
lung carcinoma 2844 1.59013409084274E-28
non-small cell lung cancer 2798 3.72249072893537E-14
pilocytic astrocytoma 3086 2.9496135320878E-5
osteosarcoma 7933 1.81244569683377E-4
ulcerative colitis 2087 8.91850827825149E-4
COPD 116 0.00136255742383183
cutaneous lupus erythematosus 1056 0.00165562258481702
pediatric high grade glioma 2712 0.0024546791889639
invasive ductal carcinoma 2950 0.00251794303959909
Rheumatoid Arthritis 1171 0.00333929912466373
glioblastoma 5572 0.00370427071275073
interstitial cystitis 2299 0.0039211753405847
psoriasis 6685 0.00590440451017467
astrocytoma 1493 0.0109085856501255
ductal carcinoma in situ 1745 0.0233156779310955
subependymal giant cell astrocytoma 2287 0.028173476812269
spina bifida 1064 0.0479410895026625
Disease Target Count Z-score Confidence
Cancer 2346 3.639 1.8
Beta thalassemia 19 3.144 1.6

Expression

  Differential Expression (17)

Disease log2 FC p
Rheumatoid Arthritis -2.700 0.003
cutaneous lupus erythematosus 2.400 0.002
psoriasis -1.200 0.006
osteosarcoma -3.510 0.000
astrocytoma 1.800 0.011
glioblastoma 1.900 0.004
non-small cell lung cancer -1.847 0.000
interstitial cystitis 2.700 0.004
pediatric high grade glioma 1.500 0.002
pilocytic astrocytoma 1.600 0.000
subependymal giant cell astrocytoma 1.556 0.028
invasive ductal carcinoma 1.500 0.003
COPD -1.200 0.001
lung carcinoma -2.400 0.000
spina bifida 1.517 0.048
ductal carcinoma in situ 1.500 0.023
ulcerative colitis 2.500 0.001

Synonym

Accession P11049 B4DVC1 Q3KPF9
Symbols GP52-40
TSPAN26

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (11)

PMID Text
25934707 Data indicate that cell differentiation antigen 37 (CD37) is well expressed and a potential drug target in acute myeloid leukemia (AML).
25275127 Human CD37 is relocalized from plasma membrane to a perinuclear area in the presence of HIV-1 Vpu
24445867 The CD37-targeted antibody-drug conjugate IMGN529 is highly active against human CLL and in a novel CD37 transgenic murine leukemia model.
23883821 Data indicate that enhanced antibody-dependent cell cytotoxicity (ADCC) is observed against chronic lymphocytic leukemia cells and is sustained at concentrations of SMIP-016(GV) as low at 5E(-6) microg/mL on cells expressing minimal CD37 antigen.
22624718 Identify two tyrosine residues in tetraspanin CD37 directly mediating transduction of survival and apoptotic signals.
20709950 In the absence of both CD37 and Tssc6, immune function is further altered when compared with CD37- or Tssc6-deficient transgenic mice, demonstrating a complementary role for these two molecules in cellular immunity.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17440052 provide strong justification for CD37 as a therapeutic target and introduce small modular immunopharmaceuticals as a novel class of targeted therapies for B-cell malignancies
17182550 CD37 is important for dectin-1 stabilization in APC membranes and controls dectin-1-mediated IL-6 production.
More...

AA Sequence

MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLAFVPLQIWSKVLAISGIFTMG      1 - 70
IALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRAQLERSLRDVVEKTIQKYGTNPEETAAE     71 - 140
ESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARS    141 - 210
RHSADICAVPAESHIYREGCAQGLQKWLHNNLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARY    211 - 280
R//

Text Mined References (29)

PMID Year Title
25934707 2015 AGS67E, an Anti-CD37 Monomethyl Auristatin E Antibody-Drug Conjugate as a Potential Therapeutic for B/T-Cell Malignancies and AML: A New Role for CD37 in AML.
24445867 2014 The CD37-targeted antibody-drug conjugate IMGN529 is highly active against human CLL and in a novel CD37 transgenic murine leukemia model.
23883821 Glycovariant anti-CD37 monospecific protein therapeutic exhibits enhanced effector cell-mediated cytotoxicity against chronic and acute B cell malignancies.
22624718 2012 Tetraspanin CD37 directly mediates transduction of survival and apoptotic signals.
21930792 2011 SCIMP, a transmembrane adaptor protein involved in major histocompatibility complex class II signaling.
20709950 2010 A complementary role for the tetraspanins CD37 and Tssc6 in cellular immunity.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...