Property Summary

NCBI Gene PubMed Count 27
Grant Count 20
R01 Count 4
Funding $3,911,415.52
PubMed Score 88.75
PubTator Score 63.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Rheumatoid Arthritis -2.700 0.003
cutaneous lupus erythematosus 2.400 0.002
psoriasis -1.200 0.006
osteosarcoma -3.510 0.000
astrocytoma 1.800 0.011
glioblastoma 1.900 0.004
non-small cell lung cancer -1.847 0.000
interstitial cystitis 2.700 0.004
pediatric high grade glioma 1.500 0.002
pilocytic astrocytoma 1.600 0.000
subependymal giant cell astrocytoma 1.556 0.028
invasive ductal carcinoma 1.500 0.003
COPD -1.200 0.001
lung carcinoma -2.400 0.000
spina bifida 1.517 0.048
ductal carcinoma in situ 1.500 0.023
ulcerative colitis 2.500 0.001

Gene RIF (14)

PMID Text
25934707 Data indicate that cell differentiation antigen 37 (CD37) is well expressed and a potential drug target in acute myeloid leukemia (AML).
25275127 Human CD37 is relocalized from plasma membrane to a perinuclear area in the presence of HIV-1 Vpu
25275127 Human CD37 is relocalized from plasma membrane to a perinuclear area in the presence of HIV-1 Vpu
25275127 Human CD37 is relocalized from plasma membrane to a perinuclear area in the presence of HIV-1 Vpu
25275127 Human CD37 is relocalized from plasma membrane to a perinuclear area in the presence of HIV-1 Vpu
24445867 The CD37-targeted antibody-drug conjugate IMGN529 is highly active against human CLL and in a novel CD37 transgenic murine leukemia model.
23883821 Data indicate that enhanced antibody-dependent cell cytotoxicity (ADCC) is observed against chronic lymphocytic leukemia cells and is sustained at concentrations of SMIP-016(GV) as low at 5E(-6) microg/mL on cells expressing minimal CD37 antigen.
22624718 Identify two tyrosine residues in tetraspanin CD37 directly mediating transduction of survival and apoptotic signals.
20709950 In the absence of both CD37 and Tssc6, immune function is further altered when compared with CD37- or Tssc6-deficient transgenic mice, demonstrating a complementary role for these two molecules in cellular immunity.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLAFVPLQIWSKVLAISGIFTMG      1 - 70
IALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRAQLERSLRDVVEKTIQKYGTNPEETAAE     71 - 140
ESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARS    141 - 210
RHSADICAVPAESHIYREGCAQGLQKWLHNNLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARY    211 - 280
R//

Text Mined References (29)

PMID Year Title
25934707 2015 AGS67E, an Anti-CD37 Monomethyl Auristatin E Antibody-Drug Conjugate as a Potential Therapeutic for B/T-Cell Malignancies and AML: A New Role for CD37 in AML.
24445867 2014 The CD37-targeted antibody-drug conjugate IMGN529 is highly active against human CLL and in a novel CD37 transgenic murine leukemia model.
23883821 Glycovariant anti-CD37 monospecific protein therapeutic exhibits enhanced effector cell-mediated cytotoxicity against chronic and acute B cell malignancies.
22624718 2012 Tetraspanin CD37 directly mediates transduction of survival and apoptotic signals.
21930792 2011 SCIMP, a transmembrane adaptor protein involved in major histocompatibility complex class II signaling.
20709950 2010 A complementary role for the tetraspanins CD37 and Tssc6 in cellular immunity.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...