Property Summary

NCBI Gene PubMed Count 85
PubMed Score 56.68
PubTator Score 49.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (30)

Disease log2 FC p
acute quadriplegic myopathy 1.001 6.0e-04
adult high grade glioma 1.200 1.7e-03
astrocytoma 2.200 5.2e-03
Astrocytoma, Pilocytic 1.300 3.6e-05
atypical teratoid / rhabdoid tumor 2.500 5.4e-06
autosomal dominant Emery-Dreifuss muscul... 1.008 9.7e-03
breast carcinoma -1.600 1.6e-04
dermatomyositis 1.100 9.6e-03
Duchenne muscular dystrophy 1.164 7.9e-07
ductal carcinoma in situ -1.100 1.2e-02
ependymoma 1.400 1.3e-08
fibroadenoma -1.300 5.0e-02
gastric carcinoma 1.500 8.1e-03
glioblastoma 1.700 1.6e-06
invasive ductal carcinoma -1.500 8.0e-03
juvenile dermatomyositis 1.184 1.1e-10
lung cancer 1.300 7.7e-05
malignant mesothelioma -1.900 7.5e-08
medulloblastoma 1.400 5.1e-04
medulloblastoma, large-cell 1.600 1.1e-05
Multiple myeloma 1.278 9.8e-03
nasopharyngeal carcinoma 1.100 7.5e-04
non-small cell lung cancer 1.102 7.2e-17
osteosarcoma 1.299 5.0e-03
ovarian cancer 1.200 3.8e-02
pancreatic cancer 1.900 5.3e-03
primary pancreatic ductal adenocarcinoma 1.962 3.3e-03
primitive neuroectodermal tumor 1.300 3.1e-03
subependymal giant cell astrocytoma 1.198 2.1e-02
ulcerative colitis 1.400 2.7e-04

Gene RIF (46)

AA Sequence

MRGSHRAAPALRPRGRLWPVLAVLAAAAAAGCAQAAMDECTDEGGRPQRCMPEFVNAAFNVTVVATNTCG      1 - 70
TPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQTMLAGVQYPSSINLTLHLG     71 - 140
KAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGFIRTGGDEQQALCTDEFS    141 - 210
DISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDF    211 - 280
AVGGRCKCNGHASECMKNEFDKLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQE    281 - 350
CYFDPELYRSTGHGGHCTNCQDNTDGAHCERCRENFFRLGNNEACSSCHCSPVGSLSTQCDSYGRCSCKP    351 - 420
GVMGDKCDRCQPGFHSLTEAGCRPCSCDPSGSIDECNIETGRCVCKDNVEGFNCERCKPGFFNLESSNPR    421 - 490
GCTPCFCFGHSSVCTNAVGYSVYSISSTFQIDEDGWRAEQRDGSEASLEWSSERQDIAVISDSYFPRYFI    491 - 560
APAKFLGKQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGLRVSVPLIAQGNSYPSETTVKYVFRLHEA    561 - 630
TDYPWRPALTPFEFQKLLNNLTSIKIRGTYSERSAGYLDDVTLASARPGPGVPATWVESCTCPVGYGGQF    631 - 700
CEMCLSGYRRETPNLGPYSPCVLCACNGHSETCDPETGVCNCRDNTAGPHCEKCSDGYYGDSTAGTSSDC    701 - 770
QPCPCPGGSSCAVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCSDNIDPNAVG    771 - 840
NCNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACNCNLYGTMKQQSSCNPVTGQCECLPH    841 - 910
VTGQDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITGQHCERCEVNHFGFGPEGC    911 - 980
KPCDCHPEGSLSLQCKDDGRCECREGFVGNRCDQCEENYFYNRSWPGCQECPACYRLVKDKVADHRVKLQ    981 - 1050
ELESLIANLGTGDEMVTDQAFEDRLKEAEREVMDLLREAQDVKDVDQNLMDRLQRVNNTLSSQISRLQNI   1051 - 1120
RNTIEETGNLAEQARAHVENTERLIEIASRELEKAKVAAANVSVTQPESTGDPNNMTLLAEEARKLAERH   1121 - 1190
KQEADDIVRVAKTANDTSTEAYNLLLRTLAGENQTAFEIEELNRKYEQAKNISQDLEKQAARVHEEAKRA   1191 - 1260
GDKAVEIYASVAQLSPLDSETLENEANNIKMEAENLEQLIDQKLKDYEDLREDMRGKELEVKNLLEKGKT   1261 - 1330
EQQTADQLLARADAAKALAEEAAKKGRDTLQEANDILNNLKDFDRRVNDNKTAAEEALRKIPAINQTITE   1331 - 1400
ANEKTREAQQALGSAAADATEAKNKAHEAERIASAVQKNATSTKAEAERTFAEVTDLDNEVNNMLKQLQE   1401 - 1470
AEKELKRKQDDADQDMMMAGMASQAAQEAEINARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEG   1471 - 1540
TLNKAKDEMKVSDLDRKVSDLENEAKKQEAAIMDYNRDIEEIMKDIRNLEDIRKTLPSGCFNTPSIEKP    1541 - 1609
//

Text Mined References (93)

PMID Year Title