Property Summary

NCBI Gene PubMed Count 79
PubMed Score 53.63
PubTator Score 49.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
non-small cell lung cancer 2798 7.17435206496408E-17
juvenile dermatomyositis 1189 1.09123492539219E-10
posterior fossa group A ependymoma 1511 3.42661251285481E-10
malignant mesothelioma 3163 7.49855359071634E-8
Duchenne muscular dystrophy 602 7.94393514594499E-7
atypical teratoid / rhabdoid tumor 4369 5.36260869264617E-6
medulloblastoma, large-cell 6234 1.13584853435615E-5
pediatric high grade glioma 2712 5.05155975549895E-5
pilocytic astrocytoma 3086 5.38633387283E-5
lung cancer 4473 7.68571016542534E-5
breast carcinoma 1614 1.59902759795162E-4
ulcerative colitis 2087 1.85833237583396E-4
sonic hedgehog group medulloblastoma 1482 2.58167553889083E-4
invasive ductal carcinoma 2950 3.62855818454584E-4
acute quadriplegic myopathy 1157 5.97586872527113E-4
nasopharyngeal carcinoma 1056 7.50682232945226E-4
glioblastoma 5572 0.00181665634794286
primitive neuroectodermal tumor 3031 0.00312704376623024
primary pancreatic ductal adenocarcinoma 1271 0.00325475800008722
astrocytoma 1493 0.0052278754976224
pancreatic cancer 2300 0.0052796592678407
ductal carcinoma in situ 1745 0.00734380519113425
gastric carcinoma 832 0.00812871474210058
osteosarcoma 7933 0.00896566359170437
dermatomyositis 967 0.00960733548940859
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00972023051107514
Multiple myeloma 1328 0.00983159842759595
subependymal giant cell astrocytoma 2287 0.0214301689610219
ovarian cancer 8492 0.0377934522058463
fibroadenoma 557 0.0497031999819099
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Junctional epidermolysis bullosa 9 3.489 1.7
Lipoid proteinosis 6 3.036 1.5

Expression

Synonym

Accession P11047 Q5VYE7
Symbols LAMB2

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

 GWAS Trait (1)

Gene RIF (42)

PMID Text
26343160 LAMC1 may contribute to the development and progression of uterine carcinoma, likely through enhancing tumor cell motility and invasion.
26074471 Case Report: Anti-laminin-gamma 1 pemphigoid in patient with generalized pustular psoriasis and psoriasis vulgaris.
26052614 The identification of laminin gamma 1 (LAMC1) and myeloid cell leukemia 1 (MCL1) as direct targets of miR-22 and miR-29a, respectively, suggested a tumor-suppressive role of these miRNAs.
24951930 Laminins 411 and 421 differentially promote tumor cell migration via alpha6beta1 integrin and MCAM (CD146).
24820027 Data showed that LAMC1 expression is directly regulated by miR-29s.
24742657 Treatment with cannabinoids inhibits HIV-1 Tat-enhanced attachment of U937 cells to collagen IV, laminin, or ECM1 proteins, which is linked to the cannabinoid receptor type 2 and the modulation of beta1-integrin and actin distribution
24733442 Case Report: occurrence of anti-laminin-gamma1 pemphigoid in a case of autosomal recessive congenital ichthyosis.
24300951 These findings document a pathogenic potential of antibodies targeting the laminin gamma1 N-terminus.
24180678 carbohydrate moiety (alpha-Gal) on laminin gamma-1 and collagen alpha-1 (VI) chain are possibly common IgE-reactive proteins in the Japanese patients with beef allergy
23674478 results demonstrate that mutation in either NID1 or LAMC1 disrupts the interaction NID1-LAMC1 complex; findings implicate the extracellular matrix in the pathogenesis of Dandy-Walker spectrum disorders
More...

AA Sequence

MRGSHRAAPALRPRGRLWPVLAVLAAAAAAGCAQAAMDECTDEGGRPQRCMPEFVNAAFNVTVVATNTCG      1 - 70
TPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQTMLAGVQYPSSINLTLHLG     71 - 140
KAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGFIRTGGDEQQALCTDEFS    141 - 210
DISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDF    211 - 280
AVGGRCKCNGHASECMKNEFDKLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQE    281 - 350
CYFDPELYRSTGHGGHCTNCQDNTDGAHCERCRENFFRLGNNEACSSCHCSPVGSLSTQCDSYGRCSCKP    351 - 420
GVMGDKCDRCQPGFHSLTEAGCRPCSCDPSGSIDECNIETGRCVCKDNVEGFNCERCKPGFFNLESSNPR    421 - 490
GCTPCFCFGHSSVCTNAVGYSVYSISSTFQIDEDGWRAEQRDGSEASLEWSSERQDIAVISDSYFPRYFI    491 - 560
APAKFLGKQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGLRVSVPLIAQGNSYPSETTVKYVFRLHEA    561 - 630
TDYPWRPALTPFEFQKLLNNLTSIKIRGTYSERSAGYLDDVTLASARPGPGVPATWVESCTCPVGYGGQF    631 - 700
CEMCLSGYRRETPNLGPYSPCVLCACNGHSETCDPETGVCNCRDNTAGPHCEKCSDGYYGDSTAGTSSDC    701 - 770
QPCPCPGGSSCAVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCSDNIDPNAVG    771 - 840
NCNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACNCNLYGTMKQQSSCNPVTGQCECLPH    841 - 910
VTGQDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITGQHCERCEVNHFGFGPEGC    911 - 980
KPCDCHPEGSLSLQCKDDGRCECREGFVGNRCDQCEENYFYNRSWPGCQECPACYRLVKDKVADHRVKLQ    981 - 1050
ELESLIANLGTGDEMVTDQAFEDRLKEAEREVMDLLREAQDVKDVDQNLMDRLQRVNNTLSSQISRLQNI   1051 - 1120
RNTIEETGNLAEQARAHVENTERLIEIASRELEKAKVAAANVSVTQPESTGDPNNMTLLAEEARKLAERH   1121 - 1190
KQEADDIVRVAKTANDTSTEAYNLLLRTLAGENQTAFEIEELNRKYEQAKNISQDLEKQAARVHEEAKRA   1191 - 1260
GDKAVEIYASVAQLSPLDSETLENEANNIKMEAENLEQLIDQKLKDYEDLREDMRGKELEVKNLLEKGKT   1261 - 1330
EQQTADQLLARADAAKALAEEAAKKGRDTLQEANDILNNLKDFDRRVNDNKTAAEEALRKIPAINQTITE   1331 - 1400
ANEKTREAQQALGSAAADATEAKNKAHEAERIASAVQKNATSTKAEAERTFAEVTDLDNEVNNMLKQLQE   1401 - 1470
AEKELKRKQDDADQDMMMAGMASQAAQEAEINARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEG   1471 - 1540
TLNKAKDEMKVSDLDRKVSDLENEAKKQEAAIMDYNRDIEEIMKDIRNLEDIRKTLPSGCFNTPSIEKP    1541 - 1609
//

Text Mined References (87)

PMID Year Title
26343160 2015 Laminin C1 expression by uterine carcinoma cells is associated with tumor progression.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26074471 2016 Anti-laminin-gamma 1 Pemphigoid with Generalized Pustular Psoriasis and Psoriasis Vulgaris.
26052614 2015 miR-22 and miR-29a Are Members of the Androgen Receptor Cistrome Modulating LAMC1 and Mcl-1 in Prostate Cancer.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24951930 2014 Laminins 411 and 421 differentially promote tumor cell migration via ?6?1 integrin and MCAM (CD146).
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24820027 2014 Tumor-suppressive microRNA-29s inhibit cancer cell migration and invasion via targeting LAMC1 in prostate cancer.
24733442 2015 Anti-laminin-?1 pemphigoid developed in a case of autosomal recessive congenital ichthyosis.
24300951 2014 Ex vivo pathogenicity of anti-laminin ?1 autoantibodies.
More...