Property Summary

NCBI Gene PubMed Count 404
Grant Count 322
R01 Count 209
Funding $41,603,399.46
PubMed Score 2003.28
PubTator Score 1221.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 1.052 0.024
osteosarcoma -1.022 0.001
astrocytoma 1.600 0.012
glioblastoma 1.900 0.019
acute quadriplegic myopathy 1.229 0.000
pancreatic ductal adenocarcinoma liver m... -1.497 0.001
tuberculosis -1.200 0.000
active Crohn's disease 1.105 0.017
Breast cancer 3.500 0.026
non primary Sjogren syndrome sicca 1.700 0.045
lung adenocarcinoma 1.195 0.000
ovarian cancer 2.400 0.000
pancreatic cancer -1.200 0.006

Synonym

Accession P11021 B0QZ61 Q2EF78 Q9NPF1 Q9UK02 GRP-78
Symbols BIP
MIF2
GRP78
HEL-S-89n

Gene

PANTHER Protein Class (2)

PDB

3IUC   3LDL   3LDN   3LDO   3LDP   5E84   5E85   5E86   5EVZ   5EX5   5EXW   5EY4   5F0X   5F1X   5F2R  

Gene RIF (329)

PMID Text
27002159 This work demonstrates that alpha2M*/CS-GRP78 acts as an upstream regulator of the PDK1/PLK1 signaling axis to modulate c-MYC transcription and its target genes, suggesting a therapeutic strategy for targeting c-MYC-associated malignant progression.
26618558 GRP78 phosphorylation in sperm undergoes spatial reorganization during epididymal maturation.
26530532 The present data suggest that GRP78 plays a crucial role in the proliferation, migration, and invasion of pancreatic cancer cells and may be a suitable prognostic marker in pancreatic ductal adenocarcinoma.
26504039 Up-regulation of BiP is associated with Pancreatic Neuroendocrine Tumors.
26472187 we report that GRP78 plays a crucial role in protecting renal cell carcinoma cells from hypoxic and hypoglycemic stress induced by anti-angiogenic therapy
26327128 Data show that molecular chaperone GRP78 and survivin cooperatively conferred multi-drug resistance (MDR) by decreasing folate deficiency (FD)-induced reactive oxygen species (ROS) generation.
26302335 The protein chaperone GRP78 and the unfolded protein response were implicated as drivers of drug resistance. Preclinical studies show inhibiting GRP78 can reverse drug resistance. [review]
26147472 The biological interaction of amelogenin with Grp78 offers significant therapeutic potential for understanding the biological components and specific functions involved in the signal transduction of amelogenin-induced periodontal tissue regeneration.
26119938 results provide new mechanistic insights into the understanding that deacetylation of HSPA5 by HDAC6 facilitates GP78-mediated HSPA5 ubiquitination
26085089 BiP facilitates Sec61 channel closure (i.e. limits ER Ca(2+) leakage) via the Sec61 channel with the help of ERj3 and ERj6
More...

AA Sequence

MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTP      1 - 70
EGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTF     71 - 140
APEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYG    141 - 210
LDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRK    211 - 280
DNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSD    281 - 350
LKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVC    351 - 420
PLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPA    421 - 490
PRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERID    491 - 560
TRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPI    561 - 630
ISKLYGSAGPPPTGEEDTAEKDEL                                                  631 - 654
//

Text Mined References (418)

PMID Year Title
27238082 2016 Compounds Triggering ER Stress Exert Anti-Melanoma Effects and Overcome BRAF Inhibitor Resistance.
27002159 2016 Activated ?2-Macroglobulin Regulates Transcriptional Activation of c-MYC Target Genes through Cell Surface GRP78 Protein.
26657846 2016 Versatile function of the circadian protein CIPC as a regulator of Erk activation.
26618558 2015 Glucose Regulated Protein 78 Phosphorylation in Sperm Undergoes Dynamic Changes during Maturation.
26530532 2015 Elevated GRP78 expression is associated with poor prognosis in patients with pancreatic cancer.
26504039 2015 Endoplasmic Reticulum Stress in Pancreatic Neuroendocrine Tumors is Linked to Clinicopathological Parameters and Possible Epigenetic Regulations.
26472187 2015 Inhibition of endoplasmic reticulum chaperone protein glucose-regulated protein 78 potentiates anti-angiogenic therapy in renal cell carcinoma through inactivation of the PERK/eIF2? pathway.
26327128 2015 Folate deficiency-triggered redox pathways confer drug resistance in hepatocellular carcinoma.
26302335 2015 Role of GRP78 in promoting therapeutic-resistant breast cancer.
26147472 2016 Grp78 Is Critical for Amelogenin-Induced Cell Migration in a Multipotent Clonal Human Periodontal Ligament Cell Line.
More...