Property Summary

Ligand Count 8
NCBI Gene PubMed Count 458
PubMed Score 2184.44
PubTator Score 1221.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease 1.105 1.7e-02
acute quadriplegic myopathy 1.229 2.9e-05
astrocytoma 1.600 1.2e-02
Breast cancer 3.500 2.6e-02
glioblastoma 1.900 1.9e-02
lung adenocarcinoma 1.195 2.3e-11
Multiple myeloma 1.052 2.4e-02
non primary Sjogren syndrome sicca 1.700 4.5e-02
osteosarcoma -1.022 1.3e-03
ovarian cancer 2.400 3.4e-05
pancreatic cancer -1.200 6.3e-03
pancreatic ductal adenocarcinoma liver m... -1.497 5.8e-04
tuberculosis -1.100 2.1e-05

Protein-protein Interaction (1)

PDB (15)

Gene RIF (377)

AA Sequence

MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTP      1 - 70
EGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTF     71 - 140
APEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYG    141 - 210
LDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRK    211 - 280
DNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSD    281 - 350
LKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVC    351 - 420
PLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPA    421 - 490
PRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERID    491 - 560
TRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPI    561 - 630
ISKLYGSAGPPPTGEEDTAEKDEL                                                  631 - 654
//

Text Mined References (475)

PMID Year Title