Property Summary

NCBI Gene PubMed Count 249
Grant Count 275
R01 Count 179
Funding $30,849,964.45
PubMed Score 1637.57
PubTator Score 1407.42

Knowledge Summary

Patent

No data available

Synonym

Accession P10997 Q0ZD87 Q14598
Symbols DAP
IAP

Gene

PANTHER Protein Class (2)

PDB

2G48   3HGZ   1KUW   2KB8   2L86   3DG1   3FPO   3FR1   3FTH   3FTK   3FTL   3FTR   3G7V   3G7W  

Gene RIF (213)

PMID Text
26960140 Hsp72 (HSPA1A) prevents h-IAPP aggregation and toxicity.
26953503 Data suggest that IAPP/membrane interaction strongly depends on protonation state of His18; at neutral pH, N-terminal domain is stabilized/anchored to membrane, while C-terminal domain is disordered as if in solution.
26786104 These data suggest participation by both soluble and fibrillar aggregates in IAPP-induced islet inflammation. IAPP-induced activation of TLR2 and secretion of IL-1 may be important therapeutic targets to prevent amyloid-associated beta cell dysfunction.
26777153 The intramolecular hydrogen bond formation by His(18) and the possibility of His(18) participating in the formation of alpha-helical structures greatly modulated the manner of hIAPP amyloid formation.
26607804 the effect of the endoplasmic reticulum chaperone protein disulfide isomerase (PDI) on beta-cell dysfunction, was examined.
26603575 combined computational and experimental study offers detailed mechanistic insight into the complex role of zinc on IAPP aggregation and T2D development
26483547 Matrix Metalloproteinase-9 Protects Islets from Amyloid-induced Toxicity.
26352401 When copper(II) was present in the solution, no dimers were detected. Thus, the copper(II) ions disrupt the association pathway to the formation of beta-sheet rich amylin fibrils.
26331261 structural and dynamical information of amylin and CGRP
26263128 Study focused on human islet amyloid polypeptide aggregates and a de novo designed short polypeptide at lipid/water and air/glass interfaces; found that parallel beta-sheets adopt distinct orientations at various interfaces and exhibit characteristic chiroptical responses in the amide I and N-H stretch regions.
More...

AA Sequence

MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY      1 - 70
GKRNAVEVLKREPLNYLPL                                                        71 - 89
//

Text Mined References (253)

PMID Year Title
26960140 2016 Hsp72 (HSPA1A) Prevents Human Islet Amyloid Polypeptide Aggregation and Toxicity: A New Approach for Type 2 Diabetes Treatment.
26953503 2016 Conformational Dynamics of the Human Islet Amyloid Polypeptide in a Membrane Environment: Toward the Aggregation Prone Form.
26922873 2016 Amylin-mediated control of glycemia, energy balance, and cognition.
26786104 2016 Differential Activation of Innate Immune Pathways by Distinct Islet Amyloid Polypeptide (IAPP) Aggregates.
26777153 2016 How the imidazole ring modulates amyloid formation of islet amyloid polypeptide: A chemical modification study.
26607804 2016 Protein disulfide isomerase ameliorates ?-cell dysfunction in pancreatic islets overexpressing human islet amyloid polypeptide.
26603575 2015 Promotion or Inhibition of Islet Amyloid Polypeptide Aggregation by Zinc Coordination Depends on Its Relative Concentration.
26483547 2015 Matrix Metalloproteinase-9 Protects Islets from Amyloid-induced Toxicity.
26352401 2015 Rapid assessment of human amylin aggregation and its inhibition by copper(II) ions by laser ablation electrospray ionization mass spectrometry with ion mobility separation.
26331261 2015 Slow Internal Dynamics and Charge Expansion in the Disordered Protein CGRP: A Comparison with Amylin.
More...