Property Summary

NCBI Gene PubMed Count 30
PubMed Score 174.36
PubTator Score 114.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.878 0.000

Synonym

Gene

Gene RIF (23)

PMID Text
24495362 HIV-1 Nef downregulates surface expression of the beta-chain of the CD8 receptor by accelerated endocytosis; amino acid positions 57 to 58 and 174 to 175 in Nef are involved in the down modulation
24297179 CREMalpha orchestrates epigenetic remodeling of the CD8A,B through the recruitment of DNA methyltransferase (DNMT) 3a and histone methyltransferase G9a.
24047902 transcription factor cAMP-responsive element modulator alpha (CREMalpha), which is expressed at increased levels in T cells from systemic lupus erythematosus patients, contributes to transcriptional silencing of CD8A and CD8B.
22844345 HIV-1 Nef downregulates surface expression of the beta-chain of the CD8 receptor by accelerated endocytosis; amino acid positions 57 to 58 and 174 to 175 in Nef are involved in the down modulation
22013062 Nef-mediated down-modulation of CD8alphabeta is a fundamental property of primate lentiviruses.
22013062 HIV-1 Nef downregulates surface expression of the beta-chain of the CD8 receptor by accelerated endocytosis; amino acid positions 57 to 58 and 174 to 175 in Nef are involved in the down modulation
21954283 [review] Coreceptor CD8alphabeta contributes to the antigen-recognition process by binding to a largely invariant region of the MHCI molecule and by promoting intracellular signaling.
21936714 HIV-1 Nef downregulates surface expression of the beta-chain of the CD8 receptor by accelerated endocytosis; amino acid positions 57 to 58 and 174 to 175 in Nef are involved in the down modulation
21936714 HIV-1 Nef downregulates surface expression of the beta-chain of the CD8 receptor by accelerated endocytosis; amino acid positions 57 to 58 and 174 to 175 in Nef are involved in the down modulation
21922073 HIV-1 Nef downregulates surface expression of the beta-chain of the CD8 receptor by accelerated endocytosis; amino acid positions 57 to 58 and 174 to 175 in Nef are involved in the down modulation
More...

AA Sequence

MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFL      1 - 70
ALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPT     71 - 140
TAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQFYK    141 - 210
//

Text Mined References (32)

PMID Year Title
24297179 2014 cAMP responsive element modulator (CREM) ? mediates chromatin remodeling of CD8 during the generation of CD3+ CD4- CD8- T cells.
24047902 2013 cAMP-responsive element modulator ? (CREM?) trans-represses the transmembrane glycoprotein CD8 and contributes to the generation of CD3+CD4-CD8- T cells in health and disease.
22013062 2012 Down-modulation of CD8?? is a fundamental activity of primate lentiviral Nef proteins.
21954283 2011 The multiple roles of the CD8 coreceptor in T cell biology: opportunities for the selective modulation of self-reactive cytotoxic T cells.
21685912 2011 Identification of common variants influencing risk of the tauopathy progressive supranuclear palsy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19768696 2009 Novel CD8+ Treg suppress EAE by TGF-beta- and IFN-gamma-dependent mechanisms.
18490743 2008 Differential expression of the human CD8beta splice variants and regulation of the M-2 isoform by ubiquitination.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16103193 2005 Human immunodeficiency virus Nef induces rapid internalization of the T-cell coreceptor CD8alphabeta.
More...