Property Summary

NCBI Gene PubMed Count 32
PubMed Score 179.68
PubTator Score 114.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Arthritis, Juvenile 126 0.0 0.0
Disease Target Count
Juvenile arthritis 126
Disease Target Count P-value
osteosarcoma 7950 3.7e-08
Disease Target Count Z-score Confidence
Central nervous system disease 10 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 3.565 1.8
Laryngotracheitis 10 3.015 1.5
Disease Target Count
progressive supranuclear palsy 676

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.878 3.7e-08

Protein-protein Interaction (9)

Gene RIF (20)

AA Sequence

MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFL      1 - 70
ALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPT     71 - 140
TAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQFYK    141 - 210
//

Text Mined References (37)

PMID Year Title