Property Summary

NCBI Gene PubMed Count 64
Grant Count 28
R01 Count 13
Funding $2,019,867.52
PubMed Score 106.90
PubTator Score 142.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
acute quadriplegic myopathy -1.158 0.000

 GWAS Trait (1)

Gene RIF (39)

PMID Text
26116789 Myosin regulatory light chain phosphorylation enhances cardiac beta-myosin in vitro motility under load.
26074085 This review focuses on the regulatory functions of MLC-2 in the embryonic and adult heart, with an emphasis on phosphorylation-driven actions of MLC-2v in adult cardiac muscle.
25925610 FLNb enhances invasion of cancer cells through phosphorylation of MRLC and FAK.
25825243 Data suggest a mutation in MYL2 (amino acid substitution D94A; novel mutation in familial dilated cardiomyopathy) does affect conformation (reduced alpha-helical content) and function (reduced binding of myosin heavy chain; increased ATPase) of MYL2.
24861553 Four novel body mass index-associated loci near the KCNQ1(rs2237892), ALDH2/MYL2 (rs671, rs12229654), ITIH4 (rs2535633) and NT5C2 (rs11191580) genes are identified in East Asian-ancestry populations.
24578133 The basic domain (49RKKRRQRRR57) of HIV-1 Tat is essential for enhancing the FGF-induced activation of ERK, Rho-A, and MLC2 and upregulates the expression of MMP-9 in human podocytes
24184274 an interplay between phosphorylation and glycosylation of MLC2, which might be involved in the development of muscle atrophy and associated changes
23951055 Results suggest that Aurora B, but not Rho/MLCK (myosin-light-chain kinase) signaling, is essential for the localization of 2P-MRLC (myosin regulatory light chains) to the midzone in dividing HeLa cells.
23732111 Ostf1b could constitutively activate the Rho kinase 1 (ROCK1) and myosin light chain 2 (MLC2) signalling pathway that promotes cell migration, epithelial mesenchymal transition (EMT) and cytoskeletal dynamics through stress fibre formation.
23575436 Newly implicated variants (MYL2, C12orf51 and OAS1) were found to be significantly associated with 1-h plasma glucose as predisposing risk factors for type 2 diabetes.
More...

AA Sequence

MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMI      1 - 70
KEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFA     71 - 140
AFPPDVTGNLDYKNLVHIITHGEEKD                                                141 - 166
//

Text Mined References (65)

PMID Year Title
26116789 2015 Myosin regulatory light chain phosphorylation enhances cardiac ?-myosin in vitro motility under load.
26074085 2015 Functions of myosin light chain-2 (MYL2) in cardiac muscle and disease.
25925610 2015 Filamin B Enhances the Invasiveness of Cancer Cells into 3D Collagen Matrices.
25825243 2015 Novel familial dilated cardiomyopathy mutation in MYL2 affects the structure and function of myosin regulatory light chain.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
24184274 2013 Potential regulation of human muscle plasticity by MLC2 post-translational modifications during bed rest and countermeasures.
23951055 2013 Aurora B but not rho/MLCK signaling is required for localization of diphosphorylated myosin II regulatory light chain to the midzone in cytokinesis.
23732111 2013 Osmotic stress transcription factor 1b (Ostf1b) promotes migration properties with the modulation of epithelial mesenchymal transition (EMT) phenotype in human embryonic kidney cell.
23575436 2013 New susceptibility loci in MYL2, C12orf51 and OAS1 associated with 1-h plasma glucose as predisposing risk factors for type 2 diabetes in the Korean population.
23365102 2013 Recessive MYL2 mutations cause infantile type I muscle fibre disease and cardiomyopathy.
More...