Property Summary

NCBI Gene PubMed Count 75
PubMed Score 155.77
PubTator Score 142.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
acute quadriplegic myopathy -1.158 1.1e-05

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (49)

AA Sequence

MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMI      1 - 70
KEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFA     71 - 140
AFPPDVTGNLDYKNLVHIITHGEEKD                                                141 - 166
//

Text Mined References (76)

PMID Year Title