Property Summary

NCBI Gene PubMed Count 39
PubMed Score 145.57
PubTator Score 74.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.508 4.8e-02
atypical teratoid/rhabdoid tumor 1.400 4.7e-02
Breast cancer 3.700 4.5e-02
colon cancer -1.200 2.6e-03
ependymoma 1.700 9.0e-03
glioblastoma -1.200 1.5e-02
interstitial cystitis -1.100 1.9e-02
malignant mesothelioma 4.500 7.2e-09
medulloblastoma -1.300 2.5e-03
medulloblastoma, large-cell -2.400 3.4e-05
non diabetic and post-ischemic heart fai... 1.300 1.2e-02
oligodendroglioma 2.500 1.1e-02
osteosarcoma 3.875 2.6e-02
ovarian cancer 1.300 1.5e-08
psoriasis -1.100 3.8e-10
type II diabetes mellitus and post-ische... 1.800 4.5e-02
ulcerative colitis -1.185 3.2e-02
urothelial carcinoma 1.700 5.0e-02
X-linked cerebral adrenoleukodystrophy 4.100 6.1e-03

Gene RIF (14)

AA Sequence

MKSLLLLVLISICWADHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAF      1 - 70
GSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCE     71 - 140
VIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWL    141 - 210
SDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACL    211 - 280
NDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCF    281 - 350
RAYN                                                                      351 - 354
//

Text Mined References (41)

PMID Year Title