Property Summary

NCBI Gene PubMed Count 37
Grant Count 60
R01 Count 44
Funding $4,628,540.95
PubMed Score 138.95
PubTator Score 74.69

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P10915 B2R9A9
Symbols CRT1
CRTL1

Gene

Gene RIF (13)

PMID Text
23748413 CSGalNAcT-1 and Hapln-1 may play important roles in the pathogenesis of Kashin-Beck disease and osteoarthritis.
22159717 HAPLN1 is overexpressed in metastatic melanoma and is secreted exclusively by the tumor cells
20953637 Single-nucleotide polymorphism in the hyaluronan and proteoglycan link protein 1 (HAPLN1) gene is associated with spinal osteophyte formation and disc degeneration in Japanese women.
20953637 Observational study of gene-disease association. (HuGE Navigator)
20950796 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20584105 An in vitro model of perineuronal nets has been developed demonstrating that cartilage link protein (along with hyaluronan synthase) are necessary for their formation.
20453000 Observational study of gene-disease association. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
19556317 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19351750 Overexpression of HAPLN1 and its SP-IgV domain increases tumorigenic properties of mesothelioma. Thus, targeting the SP-IgV domain may be one of the therapeutic approaches in cancer treatment.
More...

AA Sequence

MKSLLLLVLISICWADHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAF      1 - 70
GSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCE     71 - 140
VIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWL    141 - 210
SDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACL    211 - 280
NDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCF    281 - 350
RAYN                                                                      351 - 354
//

Text Mined References (39)

PMID Year Title
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23748413 2013 Abnormal expression of chondroitin sulphate N-acetylgalactosaminyltransferase 1 and Hapln-1 in cartilage with Kashin-Beck disease and primary osteoarthritis.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22159717 2012 The matrisome: in silico definition and in vivo characterization by proteomics of normal and tumor extracellular matrices.
22138694 2011 A genome-wide association study in Han Chinese identifies new susceptibility loci for ankylosing spondylitis.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
20953637 2011 Single-nucleotide polymorphism in the hyaluronan and proteoglycan link protein 1 (HAPLN1) gene is associated with spinal osteophyte formation and disc degeneration in Japanese women.
20950796 2011 Candidate gene analysis of the human natural killer-1 carbohydrate pathway and perineuronal nets in schizophrenia: B3GAT2 is associated with disease risk and cortical surface area.
20584105 2010 In vitro modeling of perineuronal nets: hyaluronan synthase and link protein are necessary for their formation and integrity.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
More...