Property Summary

NCBI Gene PubMed Count 228
PubMed Score 786.34
PubTator Score 494.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
lung carcinoma 2844 4.52546858258974E-12
non-small cell lung cancer 2798 8.30146009313926E-11
juvenile dermatomyositis 1189 8.33415629011778E-10
posterior fossa group A ependymoma 1511 3.62159359500798E-6
pilocytic astrocytoma 3086 1.90331816573479E-5
chronic lymphosyte leukemia 232 2.31878689882131E-5
invasive ductal carcinoma 2950 9.36958544029429E-5
ovarian cancer 8492 5.73482139456257E-4
cutaneous lupus erythematosus 1056 6.72456122461443E-4
active Crohn's disease 918 7.93261846156082E-4
psoriasis 6685 9.73890302091359E-4
interstitial cystitis 2299 0.00554875345815838
diabetes mellitus 1663 0.0070728381586933
primary pancreatic ductal adenocarcinoma 1271 0.00742233066019607
active ulcerative colitis 477 0.0075348886432543
glioblastoma 5572 0.0106609293241704
dermatomyositis 967 0.0128651568814625
Multiple myeloma 1328 0.017052398049779
esophageal adenocarcinoma 737 0.0217731605213828
head and neck cancer 270 0.0230849520201371
osteosarcoma 7933 0.0271176687321976
urothelial carcinoma 318 0.0314941291370974
Bipolar Disorder 266 0.0387241915810065
primary Sjogren syndrome 789 0.0416516354313945
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0486027157953372
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 4.47 2.2
Disease Target Count Z-score Confidence
Leishmaniasis 49 3.033 1.5
Multiple Sclerosis 498 3.029 1.5
Disease Target Count
gastric cancer 436

Expression

  Differential Expression (26)

Synonym

Accession P10914 Q96GG7 IRF-1
Symbols MAR
IRF-1

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GWAS Trait (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
449758 other 0 / 0 / 5 Late stage assay provider counterscreen results from the probe development effort to identify STAT1 inhibitors: fluorescence-based cell-based quantitative PCR assay to identify inhibitors of IRF-1 gene expression
449759 screening 0 / 0 / 8 Late stage assay provider counterscreen results from the probe development effort to identify STAT1 activators: fluorescence-based cell-based quantitative PCR assay to identify activators of IRF-1 gene expression

Gene RIF (210)

PMID Text
26872335 IRF1 is a transcriptional regulator of IRG1 in human macrophages.
26674566 IRF1 upregulation in fetal membranes and myometrium after term labor indicates a proinflammatory role for IRF1 in human parturition. IRF1 is involved in TLR- and cytokine-mediated signaling in human myometrium.
26510961 5AZ had a protective effect after MI by potentiation of IRF1 sumoylation and is suggested as a novel therapeutic intervention for cardiac repair.
26362649 Gene expression meta-analysis reveals immune response convergence on the IFNgamma-STAT1-IRF1 axis and adaptive immune resistance mechanisms in lymphoma
26011589 Data show that ectopic expression of interferon regulatory factor 1 (IRF-1) reduces NF-kappa B activity and suppresses TNF receptor-associated factor 2 (TRAF2) and inhibitor of apoptosis 1 protein (cIAP1) expression in breast cancer cells.
25997853 The present data demonstrate that IRF-1 could effectively promote the immune maturation and function of dendritic cells in ACS Acute Coronary Syndrome patients.
25964490 IRF-1 promotes LTx I/R injury via hepatocyte IL-15/IL-15Ralpha production and suggest that targeting IRF-1 and IL-15/IL-15Ralpha may be effective in reducing I/R injury associated with LTx.
25658920 IRF1, a transcription factor, regulates miR-203 transcription by binding to the miR-203 promoter.
25611806 IRF1 directly interacts with chromatin modifying enzymes, supporting a model where recruitment to specific target genes is mediated in part by IRF1.
25592039 A positive feedback loop between IRF1 and miR-29b may contribute to the sensitivity of colorectal cancer cells to IFN-gamma by repressing IGF1.
More...

AA Sequence

MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEK      1 - 70
EPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSC     71 - 140
GDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLY    141 - 210
NFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEI    211 - 280
DSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP                             281 - 325
//

Text Mined References (234)

PMID Year Title
26872335 2016 Gene Regulatory Network Inference of Immunoresponsive Gene 1 (IRG1) Identifies Interferon Regulatory Factor 1 (IRF1) as Its Transcriptional Regulator in Mammalian Macrophages.
26674566 2016 The Transcription Factor Interferon Regulatory Factor-1 (IRF1) Plays a Key Role in the Terminal Effector Pathways of Human Preterm Labor.
26510961 2015 5-Azacytidine modulates interferon regulatory factor 1 in macrophages to exert a cardioprotective effect.
26362649 2015 Gene expression meta-analysis reveals immune response convergence on the IFN?-STAT1-IRF1 axis and adaptive immune resistance mechanisms in lymphoma.
26011589 2015 IRF-1 inhibits NF-?B activity, suppresses TRAF2 and cIAP1 and induces breast cancer cell specific growth inhibition.
25997853 2015 IFN Regulatory Factor-1 Modulates the Function of Dendritic Cells in Patients with Acute Coronary Syndrome.
25964490 2015 IRF-1 promotes liver transplant ischemia/reperfusion injury via hepatocyte IL-15/IL-15R? production.
25658920 2015 BANF1 is downregulated by IRF1-regulated microRNA-203 in cervical cancer.
25611806 2015 Interferon regulatory factor 1 and histone H4 acetylation in systemic lupus erythematosus.
25592039 2015 IFN-?-mediated IRF1/miR-29b feedback loop suppresses colorectal cancer cell growth and metastasis by repressing IGF1.
More...