Property Summary

NCBI Gene PubMed Count 249
PubMed Score 827.71
PubTator Score 494.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 1.5
Disease Target Count Z-score Confidence
Cancer 2499 4.529 2.3

Expression

  Differential Expression (26)

Disease log2 FC p
lung cancer -2.100 1.8e-05
active Crohn's disease 1.530 2.1e-03
active ulcerative colitis 1.414 4.1e-03
Bipolar Disorder 1.244 3.9e-02
chronic lymphosyte leukemia -1.100 2.3e-05
cutaneous lupus erythematosus 2.100 6.7e-04
dermatomyositis 1.200 1.3e-02
diabetes mellitus -1.200 7.1e-03
ependymoma 1.200 5.0e-04
esophageal adenocarcinoma 1.300 2.2e-02
glioblastoma 1.100 1.1e-02
head and neck cancer 1.300 2.3e-02
interstitial cystitis 1.800 2.9e-03
intraductal papillary-mucinous neoplasm ... 1.200 4.9e-02
invasive ductal carcinoma -1.256 1.9e-03
juvenile dermatomyositis 1.208 8.3e-10
lung carcinoma -2.100 4.5e-12
Multiple myeloma 1.512 1.7e-02
non-small cell lung cancer -1.386 1.5e-10
osteosarcoma -1.050 2.7e-02
ovarian cancer 1.400 5.7e-04
Pilocytic astrocytoma 1.100 1.9e-05
primary pancreatic ductal adenocarcinoma 1.090 7.4e-03
primary Sjogren syndrome 1.200 4.2e-02
psoriasis 1.600 9.7e-04
urothelial carcinoma -1.300 3.1e-02

Gene RIF (230)

AA Sequence

MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEK      1 - 70
EPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSC     71 - 140
GDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLY    141 - 210
NFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEI    211 - 280
DSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP                             281 - 325
//

Text Mined References (254)

PMID Year Title