Property Summary

NCBI Gene PubMed Count 228
Grant Count 272
R01 Count 156
Funding $23,589,270.77
PubMed Score 786.34
PubTator Score 494.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Synonym

Accession P10914 Q96GG7 IRF-1
Symbols MAR
IRF-1

Gene

 GWAS Trait (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
449758 other 0 / 0 / 5 Late stage assay provider counterscreen results from the probe development effort to identify STAT1 inhibitors: fluorescence-based cell-based quantitative PCR assay to identify inhibitors of IRF-1 gene expression
449759 screening 0 / 0 / 8 Late stage assay provider counterscreen results from the probe development effort to identify STAT1 activators: fluorescence-based cell-based quantitative PCR assay to identify activators of IRF-1 gene expression

Gene RIF (210)

PMID Text
26872335 IRF1 is a transcriptional regulator of IRG1 in human macrophages.
26674566 IRF1 upregulation in fetal membranes and myometrium after term labor indicates a proinflammatory role for IRF1 in human parturition. IRF1 is involved in TLR- and cytokine-mediated signaling in human myometrium.
26510961 5AZ had a protective effect after MI by potentiation of IRF1 sumoylation and is suggested as a novel therapeutic intervention for cardiac repair.
26362649 Gene expression meta-analysis reveals immune response convergence on the IFNgamma-STAT1-IRF1 axis and adaptive immune resistance mechanisms in lymphoma
26011589 Data show that ectopic expression of interferon regulatory factor 1 (IRF-1) reduces NF-kappa B activity and suppresses TNF receptor-associated factor 2 (TRAF2) and inhibitor of apoptosis 1 protein (cIAP1) expression in breast cancer cells.
25997853 The present data demonstrate that IRF-1 could effectively promote the immune maturation and function of dendritic cells in ACS Acute Coronary Syndrome patients.
25964490 IRF-1 promotes LTx I/R injury via hepatocyte IL-15/IL-15Ralpha production and suggest that targeting IRF-1 and IL-15/IL-15Ralpha may be effective in reducing I/R injury associated with LTx.
25658920 IRF1, a transcription factor, regulates miR-203 transcription by binding to the miR-203 promoter.
25611806 IRF1 directly interacts with chromatin modifying enzymes, supporting a model where recruitment to specific target genes is mediated in part by IRF1.
25592039 A positive feedback loop between IRF1 and miR-29b may contribute to the sensitivity of colorectal cancer cells to IFN-gamma by repressing IGF1.
More...

AA Sequence

MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEK      1 - 70
EPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSC     71 - 140
GDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLY    141 - 210
NFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEI    211 - 280
DSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP                             281 - 325
//

Text Mined References (234)

PMID Year Title
26872335 2016 Gene Regulatory Network Inference of Immunoresponsive Gene 1 (IRG1) Identifies Interferon Regulatory Factor 1 (IRF1) as Its Transcriptional Regulator in Mammalian Macrophages.
26674566 2016 The Transcription Factor Interferon Regulatory Factor-1 (IRF1) Plays a Key Role in the Terminal Effector Pathways of Human Preterm Labor.
26510961 2015 5-Azacytidine modulates interferon regulatory factor 1 in macrophages to exert a cardioprotective effect.
26362649 2015 Gene expression meta-analysis reveals immune response convergence on the IFN?-STAT1-IRF1 axis and adaptive immune resistance mechanisms in lymphoma.
26011589 2015 IRF-1 inhibits NF-?B activity, suppresses TRAF2 and cIAP1 and induces breast cancer cell specific growth inhibition.
25997853 2015 IFN Regulatory Factor-1 Modulates the Function of Dendritic Cells in Patients with Acute Coronary Syndrome.
25964490 2015 IRF-1 promotes liver transplant ischemia/reperfusion injury via hepatocyte IL-15/IL-15R? production.
25658920 2015 BANF1 is downregulated by IRF1-regulated microRNA-203 in cervical cancer.
25611806 2015 Interferon regulatory factor 1 and histone H4 acetylation in systemic lupus erythematosus.
25592039 2015 IFN-?-mediated IRF1/miR-29b feedback loop suppresses colorectal cancer cell growth and metastasis by repressing IGF1.
More...