Property Summary

Ligand Count 3
NCBI Gene PubMed Count 288
PubMed Score 1322.59
PubTator Score 1302.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Melanoma 711 0.0 0.5
Disease Target Count Z-score Confidence
Iron metabolism disease 20 0.0 0.8
Systemic lupus erythematosus 194 0.0 1.1

Expression

  Differential Expression (25)

Disease log2 FC p
active ulcerative colitis -2.585 4.2e-02
Astrocytoma, Pilocytic 1.700 6.6e-06
Atopic dermatitis -1.400 3.1e-03
Breast cancer -1.600 3.0e-03
breast carcinoma -1.300 2.1e-03
cystic fibrosis -1.700 2.5e-03
ductal carcinoma in situ -3.600 8.5e-05
fibroadenoma -1.900 1.6e-02
group 3 medulloblastoma 1.200 3.8e-02
interstitial cystitis -1.200 8.0e-03
intraductal papillary-mucinous adenoma (... -2.600 7.8e-04
intraductal papillary-mucinous carcinoma... -2.900 8.9e-04
intraductal papillary-mucinous neoplasm ... -3.000 6.3e-03
invasive ductal carcinoma -1.408 1.4e-04
lung adenocarcinoma -1.700 7.3e-16
lung cancer -1.800 9.0e-03
lung carcinoma -1.700 6.0e-15
malignant mesothelioma -1.200 2.4e-04
medulloblastoma, large-cell -1.500 1.3e-02
nasopharyngeal carcinoma 2.100 8.3e-03
non-small cell lung carcinoma -1.200 2.0e-13
oligodendroglioma -1.300 1.4e-02
ovarian cancer -5.100 2.6e-23
pancreatic ductal adenocarcinoma liver m... -2.844 1.3e-03
psoriasis -1.400 1.1e-05

Protein-protein Interaction (1)

Gene RIF (252)

AA Sequence

MDLWQLLLTLALAGSSDAFSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTD      1 - 70
EVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKC     71 - 140
FSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPI    141 - 210
LTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFYFPWLLIIIFGIFGLTV    211 - 280
MLFVFLFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILAIHDSYKPEFHSDDSWVEFIELDI    281 - 350
DEPDEKTEESDTDRLLSSDHEKSHSNLGVKDGDSGRTSCCEPDILETDFNANDIHEGTSEVAQPQRLKGE    351 - 420
ADLLCLDQKNQNNSPYHDACPATQQPSVIQAEKNKPQPLPTEGAESTHQAAHIQLSNPSSLSNIDFYAQV    421 - 490
SDITPAGSVVLSPGQKNKAGMSQCDMHPEMVSLCQENFLMDNAYFCEADAKKCIPVAPHIKVESHIQPSL    491 - 560
NQEDIYITTESLTTAAGRPGTGEHVPGSEMPVPDYTSIHIVQSPQGLILNATALPLPDKEFLSSCGYVST    561 - 630
DQLNKIMP                                                                  631 - 638
//

Text Mined References (292)

PMID Year Title