Property Summary

NCBI Gene PubMed Count 34
Grant Count 174
R01 Count 110
Funding $12,881,406.83
PubMed Score 310.76
PubTator Score 107.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.800 0.011
ependymoma -2.000 0.021
oligodendroglioma -1.200 0.024
glioblastoma -1.700 0.008
medulloblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -2.500 0.000
medulloblastoma, large-cell -2.300 0.001
primitive neuroectodermal tumor -1.700 0.002
adrenocortical carcinoma -2.008 0.020
adult high grade glioma -2.100 0.000
aldosterone-producing adenoma -1.454 0.024
pituitary cancer 2.800 0.000

Gene

Gene RIF (10)

PMID Text
25723869 Results support a role for Dbl oncogene in mammary epithelial cell differentiation and transformation and suggest the relevance of GEF deregulation in tumor onset and progression.
22984590 Phosphoinositide 3-kinase C2beta regulates RhoA and the actin cytoskeleton through an interaction with Dbl
21712385 Dbl is regulated by hamartin through association with ezrin.
20479760 Observational study of gene-disease association. (HuGE Navigator)
19373475 proto-oncogene dbl is not a major target for sporadic testicular germ cell tumors
18728402 Nm23-H1 can negatively regulate cell migration and tumor metastasis by modulating the activity of Cdc42 and possibly other Rho family members through interaction with Dbl-1
17606614 Galphaq directly activates p63RhoGEF and Trio via a conserved extension of the Dbl homology-associated pleckstrin homology domain
17538024 These data suggest a mechanism whereby precise spatial guanine nucleotide exchange of Cdc42 by Dbl is dependent on functional ERM proteins and is important for directional cell migration.
13679059 provides fundamental data on the structure of Mcf-2, which regulates a variety of cellular signaling pathways
12445822 data describe 4 splicing variants of the human DBL (MCF-2) proto-oncogene that show different tissue distributions and guanine nucleotide exchange factor specificities

AA Sequence

MAEANPRRGKMRFRRNAASFPGNLHLVLVLRPTSFLQRTFTDIGFWFSQEDFMLKLPVVMLSSVSDLLTY      1 - 70
IDDKQLTPELGGTLQYCHSEWIIFRNAIENFALTVKEMAQMLQSFGTELAETELPDDIPSIEEILAIRAE     71 - 140
RYHLLKNDITAVTKEGKILLTNLEVPDTEGAVSSRLECHRQISGDWQTINKLLTQVHDMETAFDGFWEKH    141 - 210
QLKMEQYLQLWKFEQDFQQLVTEVEFLLNQQAELADVTGTIAQVKQKIKKLENLDENSQELLSKAQFVIL    211 - 280
HGHKLAANHHYALDLICQRCNELRYLSDILVNEIKAKRIQLSRTFKMHKLLQQARQCCDEGECLLANQEI    281 - 350
DKFQSKEDAQKALQDIENFLEMALPFINYEPETLQYEFDVILSPELKVQMKTIQLKLENIRSIFENQQAG    351 - 420
FRNLADKHVRPIQFVVPTPENLVTSGTPFFSSKQGKKTWRQNQSNLKIEVVPDCQEKRSSGPSSSLDNGN    421 - 490
SLDVLKNHVLNELIQTERVYVRELYTVLLGYRAEMDNPEMFDLMPPLLRNKKDILFGNMAEIYEFHNDIF    491 - 560
LSSLENCAHAPERVGPCFLERKDDFQMYAKYCQNKPRSETIWRKYSECAFFQECQRKLKHRLRLDSYLLK    561 - 630
PVQRITKYQLLLKELLKYSKDCEGSALLKKALDAMLDLLKSVNDSMHQIAINGYIGNLNELGKMIMQGGF    631 - 700
SVWIGHKKGATKMKDLARFKPMQRHLFLYEKAIVFCKRRVESGEGSDRYPSYSFKHCWKMDEVGITEYVK    701 - 770
GDNRKFEIWYGEKEEVYIVQASNVDVKMTWLKEIRNILLKQQELLTVKKRKQQDQLTERDKFQISLQQND    771 - 840
EKQQGAFISTEETELEHTSTVVEVCEAIASVQAEANTVWTEASQSAEISEEPAEWSSNYFYPTYDENEEE    841 - 910
NRPLMRPVSEMALLY                                                           911 - 925
//

Text Mined References (37)

PMID Year Title
25723869 2015 Dbl oncogene expression in MCF-10 A epithelial cells disrupts mammary acinar architecture, induces EMT and angiogenic factor secretion.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22984590 2012 Phosphoinositide 3-kinase C2? regulates RhoA and the actin cytoskeleton through an interaction with Dbl.
21712385 2011 The tumor suppressor hamartin enhances Dbl protein transforming activity through interaction with ezrin.
20479760 2011 Systematic resequencing of X-chromosome synaptic genes in autism spectrum disorder and schizophrenia.
19373475 2009 Mutational analysis of proto-oncogene Dbl on Xq27 in testicular germ cell tumors reveals a rare SNP in a patient with bilateral undescended testis.
18728402 2008 The suppressor of metastasis Nm23-H1 interacts with the Cdc42 Rho family member and the pleckstrin homology domain of oncoprotein Dbl-1 to suppress cell migration.
18470881 2008 Nm23-H1 modulates the activity of the guanine exchange factor Dbl-1.
17606614 2007 Galphaq directly activates p63RhoGEF and Trio via a conserved extension of the Dbl homology-associated pleckstrin homology domain.
17538024 2007 Activated ezrin promotes cell migration through recruitment of the GEF Dbl to lipid rafts and preferential downstream activation of Cdc42.
More...