Property Summary

NCBI Gene PubMed Count 34
PubMed Score 324.82
PubTator Score 107.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma -2.008 2.0e-02
adult high grade glioma -1.900 7.3e-05
aldosterone-producing adenoma -1.454 2.4e-02
astrocytic glioma -1.700 2.0e-02
atypical teratoid / rhabdoid tumor -2.000 8.8e-08
ependymoma -2.000 2.1e-02
glioblastoma -1.200 2.8e-03
group 3 medulloblastoma -1.100 4.0e-02
medulloblastoma, large-cell -2.000 1.9e-03
oligodendroglioma -1.200 2.4e-02
pituitary cancer 2.800 1.7e-04
primitive neuroectodermal tumor -1.700 1.9e-03

 MGI Phenotype (1)

Gene RIF (10)

AA Sequence

MAEANPRRGKMRFRRNAASFPGNLHLVLVLRPTSFLQRTFTDIGFWFSQEDFMLKLPVVMLSSVSDLLTY      1 - 70
IDDKQLTPELGGTLQYCHSEWIIFRNAIENFALTVKEMAQMLQSFGTELAETELPDDIPSIEEILAIRAE     71 - 140
RYHLLKNDITAVTKEGKILLTNLEVPDTEGAVSSRLECHRQISGDWQTINKLLTQVHDMETAFDGFWEKH    141 - 210
QLKMEQYLQLWKFEQDFQQLVTEVEFLLNQQAELADVTGTIAQVKQKIKKLENLDENSQELLSKAQFVIL    211 - 280
HGHKLAANHHYALDLICQRCNELRYLSDILVNEIKAKRIQLSRTFKMHKLLQQARQCCDEGECLLANQEI    281 - 350
DKFQSKEDAQKALQDIENFLEMALPFINYEPETLQYEFDVILSPELKVQMKTIQLKLENIRSIFENQQAG    351 - 420
FRNLADKHVRPIQFVVPTPENLVTSGTPFFSSKQGKKTWRQNQSNLKIEVVPDCQEKRSSGPSSSLDNGN    421 - 490
SLDVLKNHVLNELIQTERVYVRELYTVLLGYRAEMDNPEMFDLMPPLLRNKKDILFGNMAEIYEFHNDIF    491 - 560
LSSLENCAHAPERVGPCFLERKDDFQMYAKYCQNKPRSETIWRKYSECAFFQECQRKLKHRLRLDSYLLK    561 - 630
PVQRITKYQLLLKELLKYSKDCEGSALLKKALDAMLDLLKSVNDSMHQIAINGYIGNLNELGKMIMQGGF    631 - 700
SVWIGHKKGATKMKDLARFKPMQRHLFLYEKAIVFCKRRVESGEGSDRYPSYSFKHCWKMDEVGITEYVK    701 - 770
GDNRKFEIWYGEKEEVYIVQASNVDVKMTWLKEIRNILLKQQELLTVKKRKQQDQLTERDKFQISLQQND    771 - 840
EKQQGAFISTEETELEHTSTVVEVCEAIASVQAEANTVWTEASQSAEISEEPAEWSSNYFYPTYDENEEE    841 - 910
NRPLMRPVSEMALLY                                                           911 - 925
//

Text Mined References (37)

PMID Year Title