Property Summary

NCBI Gene PubMed Count 399
Grant Count 254
R01 Count 112
Funding $43,981,652.51
PubMed Score 1930.40
PubTator Score 889.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (64)

Disease Z-score Confidence
Alzheimer's disease 644 5.469 2.7
Limb ischemia 12 5.138 2.6
Cancer 2,346 4.631 2.3
Kidney disease 396 3.983 2.0
Dementia 129 3.9 1.9
Amyloidosis 68 3.215 1.6
Iris disease 9 3.179 1.6
Ureteral disease 23 3.115 1.6
Intermittent claudication 16 3.11 1.6
Atherosclerosis 275 3.043 1.5
AMYOTROPHIC LATERAL SCLEROSIS 1 49
Acute kidney injury 65
Adverse reaction to drug 54
Atopic dermatitis 944
Atrophic 10
Breast cancer 3,094
Degenerative polyarthritis 93
Drug-Induced Liver Injury 118
Duchenne muscular dystrophy 602
Gaucher disease type 3 76
Juvenile arthritis 124
Kidney Diseases 86
Lupus Erythematosus, Systemic 73
Melanoma 261
Panic disorder 55 1.0
Pathologic Neovascularization 6
Prostatic Neoplasms 471
Seizures 95
acute quadriplegic myopathy 1,157
astrocytoma 1,493
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
chronic kidney disease 90
chronic rhinosinusitis 512
colon cancer 1,475
cystic fibrosis 1,665
ductal carcinoma in situ 1,745
gastric cancer 430
glioblastoma 5,572
hepatocellular carcinoma 532
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
limb girdle muscular dystrophy 2A 156
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
non-small cell lung cancer 2,798
ovarian cancer 8,484
pancreatic cancer 2,300
pancreatic carcinoma 567
pancreatic ductal adenocarcinoma liver m... 1,795 
pituitary cancer 1,972
primary Sjogren syndrome 789
psoriasis 6,685
sonic hedgehog group medulloblastoma 1,482
subependymal giant cell astrocytoma 2,287
ulcerative colitis 2,087

Expression

  Differential Expression (40)

Disease log2 FC p
gastric cancer 1.500 0.001
hepatocellular carcinoma 1.300 0.003
pancreatic cancer 2.400 0.000
malignant mesothelioma 1.600 0.000
psoriasis -1.200 0.000
sonic hedgehog group medulloblastoma -3.600 0.000
astrocytoma 2.800 0.030
glioblastoma 1.200 0.016
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -4.300 0.000
Duchenne muscular dystrophy 1.368 0.000
autosomal dominant Emery-Dreifuss muscul... 1.279 0.015
juvenile dermatomyositis 1.198 0.000
acute quadriplegic myopathy 1.283 0.001
limb girdle muscular dystrophy 2A 1.305 0.000
Atopic dermatitis -1.100 0.016
chronic kidney disease 1.800 0.031
pancreatic ductal adenocarcinoma liver m... -2.621 0.016
non-small cell lung cancer -2.236 0.000
intraductal papillary-mucinous adenoma (... -1.100 0.044
intraductal papillary-mucinous carcinoma... -3.800 0.002
intraductal papillary-mucinous neoplasm ... -4.200 0.002
lung cancer -3.300 0.000
colon cancer -3.200 0.000
breast carcinoma -1.500 0.000
cystic fibrosis 3.000 0.001
primary Sjogren syndrome 1.400 0.025
pancreatic carcinoma 2.400 0.000
subependymal giant cell astrocytoma 2.187 0.003
lung adenocarcinoma -2.300 0.000
nasopharyngeal carcinoma -3.000 0.000
lung carcinoma -1.400 0.000
Breast cancer -1.500 0.000
ductal carcinoma in situ -1.700 0.042
invasive ductal carcinoma -3.200 0.001
ulcerative colitis 2.600 0.001
ovarian cancer 2.900 0.000
Gaucher disease type 3 -2.200 0.026
pituitary cancer 2.000 0.000
chronic rhinosinusitis -1.170 0.038

Synonym

Accession P10909 B2R9Q1 B3KSE6 P11380 P11381 Q2TU75 Q5HYC1 Q7Z5B9
Symbols CLI
AAG4
APOJ
CLU1
CLU2
KUB1
SGP2
APO-J
SGP-2
SP-40
TRPM2
TRPM-2
NA1/NA2

Gene

CLU

Gene RIF (339)

PMID Text
26884339 Clusterin elicits neuroprotective effect by binding to amyloid beta (1-42) oligomers with high affinity and interfering with peptide aggregation.
26826245 the antioxidant property of clusterin is suggested to regulate the expression of CCL20 in bronchial epithelial cells and the subsequent recruitment of inflammatory dendritic cells in the airway.
26810527 The results of the presented "feasibility" study support the role of clusterin in Parkinson disease pathogenesis
26757186 A low prevalence of AD was found in Tibetans from the Qinghai-Tibet plateau and negatively associated with AD in this population with the CLU genotype at rs9331888.
26738351 There was no association between CLU polymorphism and Alzheimer disease.
26683597 Clusterin expression was increased in reactive astrocytes in multiple sclerosis white matter lesions.
26673020 This review connects the biochemistry and molecular cell biology of CLU with medical aspects, to formulate a hypothesis of a CLU function in health and disease. [review]
26545630 It is an endophenotype for Alzheimer's disease and may play a role in AD by influencing immune system changes that have been observed in AD or by disrupting healing after neurodegeneration.
26488311 Plasma Clusterin glycosylation is associated with hippocampal atrophy in Alzheimer's disease patients.
26482819 This study demonstrated that Increased extracellular clusterin in the prefrontal cortex in schizophrenia.
More...

AA Sequence

MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTL      1 - 70
LSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQL     71 - 140
EEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFS    141 - 210
LPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDD    211 - 280
DRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQW    281 - 350
KMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVP    351 - 420
VEVSRKNPKFMETVAEKALQEYRKKHREE                                             421 - 449
//

Text Mined References (406)

PMID Year Title
26884339 2016 Clusterin Binds to A?1-42 Oligomers with High Affinity and Interferes with Peptide Aggregation by Inhibiting Primary and Secondary Nucleation.
26826245 2016 Clusterin Modulates Allergic Airway Inflammation by Attenuating CCL20-Mediated Dendritic Cell Recruitment.
26810527 2016 Clusterin CSF levels in differential diagnosis of neurodegenerative disorders.
26757186 2016 Lower Prevalence of Alzheimer's Disease among Tibetans: Association with Religious and Genetic Factors.
26738351 2015 Association of CLU and TLR2 gene polymorphisms with late-onset Alzheimer disease in a northwestern Iranian population.
26683597 2016 Elevated Expression of the Cerebrospinal Fluid Disease Markers Chromogranin A and Clusterin in Astrocytes of Multiple Sclerosis White Matter Lesions.
26673020 2016 The CLU-files: disentanglement of a mystery.
26545630 2016 A potential endophenotype for Alzheimer's disease: cerebrospinal fluid clusterin.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26488311 2015 Glycosylation of Human Plasma Clusterin Yields a Novel Candidate Biomarker of Alzheimer's Disease.
More...