Property Summary

NCBI Gene PubMed Count 399
PubMed Score 1930.40
PubTator Score 889.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
non-small cell lung cancer 2798 1.4e-18
breast carcinoma 1614 4.5e-18
lung carcinoma 2844 2.5e-10
sonic hedgehog group medulloblastoma 1482 1.2e-07
pituitary cancer 1972 1.7e-07
malignant mesothelioma 3163 2.3e-07
lung adenocarcinoma 2714 3.6e-06
Duchenne muscular dystrophy 602 6.1e-06
atypical teratoid / rhabdoid tumor 4369 2.5e-05
pancreatic carcinoma 567 4.0e-05
pancreatic cancer 2300 4.0e-05
limb girdle muscular dystrophy 2A 156 4.8e-05
nasopharyngeal carcinoma 1056 5.4e-05
juvenile dermatomyositis 1189 7.3e-05
psoriasis 6685 1.2e-04
colon cancer 1475 1.2e-04
lung cancer 4473 1.4e-04
Breast cancer 3098 2.3e-04
ovarian cancer 8491 2.5e-04
medulloblastoma, large-cell 6234 3.1e-04
acute quadriplegic myopathy 1157 6.4e-04
cystic fibrosis 1670 7.9e-04
gastric cancer 436 1.1e-03
invasive ductal carcinoma 2950 1.2e-03
ulcerative colitis 2087 1.4e-03
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.7e-03
intraductal papillary-mucinous neoplasm (IPMN) 3289 1.7e-03
hepatocellular carcinoma 550 2.6e-03
subependymal giant cell astrocytoma 2287 3.5e-03
autosomal dominant Emery-Dreifuss muscular dystrophy 499 1.5e-02
Atopic dermatitis 944 1.6e-02
glioblastoma 5572 1.6e-02
pancreatic ductal adenocarcinoma liver metastasis 1795 1.6e-02
primary Sjogren syndrome 788 2.5e-02
Gaucher disease type 3 76 2.6e-02
astrocytoma 1493 3.0e-02
chronic kidney disease 90 3.1e-02
chronic rhinosinusitis 512 3.8e-02
ductal carcinoma in situ 1745 4.2e-02
intraductal papillary-mucinous adenoma (IPMA) 2956 4.4e-02
Disease Target Count Z-score Confidence
Alzheimer's disease 644 5.469 2.7
Panic disorder 55 0.0 1.0

Expression

  Differential Expression (40)

Disease log2 FC p
gastric cancer 1.500 1.1e-03
hepatocellular carcinoma 1.300 2.6e-03
pancreatic cancer 2.400 4.0e-05
malignant mesothelioma 1.600 2.3e-07
psoriasis -1.200 1.2e-04
sonic hedgehog group medulloblastoma -3.600 1.2e-07
astrocytoma 2.800 3.0e-02
glioblastoma 1.200 1.6e-02
atypical teratoid / rhabdoid tumor -2.300 2.5e-05
medulloblastoma, large-cell -4.300 3.1e-04
Duchenne muscular dystrophy 1.368 6.1e-06
autosomal dominant Emery-Dreifuss muscul... 1.279 1.5e-02
juvenile dermatomyositis 1.198 7.3e-05
acute quadriplegic myopathy 1.283 6.4e-04
limb girdle muscular dystrophy 2A 1.305 4.8e-05
Atopic dermatitis -1.100 1.6e-02
chronic kidney disease 1.800 3.1e-02
pancreatic ductal adenocarcinoma liver m... -2.621 1.6e-02
non-small cell lung cancer -2.236 1.4e-18
intraductal papillary-mucinous adenoma (... -1.100 4.4e-02
intraductal papillary-mucinous carcinoma... -3.800 1.7e-03
intraductal papillary-mucinous neoplasm ... -4.200 1.7e-03
lung cancer -3.300 1.4e-04
colon cancer -3.200 1.2e-04
breast carcinoma -1.500 4.5e-18
cystic fibrosis 3.000 7.9e-04
primary Sjogren syndrome 1.400 2.5e-02
pancreatic carcinoma 2.400 4.0e-05
subependymal giant cell astrocytoma 2.187 3.5e-03
lung adenocarcinoma -2.300 3.6e-06
nasopharyngeal carcinoma -3.000 5.4e-05
lung carcinoma -1.400 2.5e-10
Breast cancer -1.500 2.3e-04
ductal carcinoma in situ -1.700 4.2e-02
invasive ductal carcinoma -3.200 1.2e-03
ulcerative colitis 2.600 1.4e-03
ovarian cancer 2.900 2.5e-04
Gaucher disease type 3 -2.200 2.6e-02
pituitary cancer 2.000 1.7e-07
chronic rhinosinusitis -1.170 3.8e-02

Gene RIF (339)

PMID Text
26884339 Clusterin elicits neuroprotective effect by binding to amyloid beta (1-42) oligomers with high affinity and interfering with peptide aggregation.
26826245 the antioxidant property of clusterin is suggested to regulate the expression of CCL20 in bronchial epithelial cells and the subsequent recruitment of inflammatory dendritic cells in the airway.
26810527 The results of the presented "feasibility" study support the role of clusterin in Parkinson disease pathogenesis
26757186 A low prevalence of AD was found in Tibetans from the Qinghai-Tibet plateau and negatively associated with AD in this population with the CLU genotype at rs9331888.
26738351 There was no association between CLU polymorphism and Alzheimer disease.
26683597 Clusterin expression was increased in reactive astrocytes in multiple sclerosis white matter lesions.
26673020 This review connects the biochemistry and molecular cell biology of CLU with medical aspects, to formulate a hypothesis of a CLU function in health and disease. [review]
26545630 It is an endophenotype for Alzheimer's disease and may play a role in AD by influencing immune system changes that have been observed in AD or by disrupting healing after neurodegeneration.
26488311 Plasma Clusterin glycosylation is associated with hippocampal atrophy in Alzheimer's disease patients.
26482819 This study demonstrated that Increased extracellular clusterin in the prefrontal cortex in schizophrenia.
26449541 We replicated the rs11136000 (CLU)- rs670139 (MS4A4E) interaction, demonstrated an association in APOE epsilon4 negative subjects, and reported evidence of a possible dominant effect for MS4A4E.
26434199 the rs11136000 of CLU SNP might be related to development of behavioral and psychological symptoms of dementia and Alzheimer's disease in female Turkish subpopulation
26399194 L1-mediated induction of CLU, via STAT-1, has an important role in L1-mediated colorectal cancer progression
26368530 Lpd of P. aeruginosa is a surface exposed moonlighting protein that binds two human terminal pathway inhibitors, vitronectin and clusterin
26293319 The expression of clusterin is significantly correlated with the biological characteristics of ovarian cancer cells, it may be a potential molecular for ovarian cancer treatment
26179372 The pathogenic effect of mutation p.I360N and 10 additional CLU mutations on protein localization and secretion suggest reduced CLU secretion as the mode of action for 3 of them: a frameshift mutation and 2 AA substituions in the disulfide bridge.
26159041 Clusterin was isolated from the pericardial fluid following myocardial infarction.
26081122 increased apoJ in hyperlipemic serum is paradoxically associated with decreased apoJ content in lipoproteins
25934174 A CLU protein isoform is upregulated in papillary carcinomas.
25917404 Clusterin promoter histone H3K9me3 and H3K27me3 marks are elevated in comparison to H3K4me3 and H3K9AcS10P marks in colon cancer cell lines.
25884382 sCLU overexpression decreased cisplatin chemosensitivity of lung cancer.
25884309 The mass spectrometry-based analysis of the global plasma proteome identified CLU as an early biomarker of colorectal cancer, at least in men.
25855029 showed that the presence of these two clusterin glycoforms differed significantly in the plasma of patients prior to and after curative nephrectomy for localized ccRCC.
25849827 Our data suggest that genetic variants in CLU and TNF-alpha genes do not play a major role in the development of PEXS and PEXG in the South Indian population.
25703218 CLU SNP rs9331888 might be associated with an increased AD risk in Caucasian population, but not in Asian population.
25609201 Clusterin is an independent predictive factor for prognosis of hepatocellular carcinoma and it facilitates metastasis through EIF3I/Akt/MMP13 signaling.
25600802 silencing CLU led to downregulation of beta-catenin (q = 13.544, P = 0.001), suggesting that downregulation of CLU might be a key point to reverse multidrug resistance of HepG2/ADM cells.
25574066 Clusterin may play a key role during tumorigenesis and tumor progression of esophageal squamous cell carcinoma.
25503391 Clusterin facilitates stress-induced lipidation of LC3 and autophagosome biogenesis to enhance cancer cell survival.
25496871 we show that young individuals with the CLU rs11136000 risk variant (C) have higher activation levels in memory-related prefrontal and limbic areas during a WM task. We also found subtle reductions in gray matter in the right hippocampal formation in carriers of the risk variant.
25478940 Using circular dichroism spectroscopy, the study determined that CLU preferentially stabilizes monomeric TTR and generates increasingly stable conformations under acid stress.
25464035 we show for the first time that the expression of CLU 2 mRNA is driven by a novel promoter, P2, whose activity responds to epigenetic drugs treatment through changes in histone modifications.
25451228 PACAP as a negative regulator of CLU
25343293 Downregulation of clusterin enhances PC3 cell sensitivity to paclitaxel.
25083615 Both urinary clusterin and IL-18 are useful biomarkers and may allow triaging of patients with delayed graft function within 4 hr of kidney transplantation.
25076422 fasting plasma clusterin levels correlate with the parameters of adiposity and systemic inflammation in healthy adults. Therefore, the circulating clusterin level may be a surrogate marker for obesity-associated systemic inflammation.
25071085 pivotal factor in the cell injury mechanism of nephropathic cystinosis
25057782 Our results reveal that rs2279590 was found to be associated with PEX in Indian population and the risk allele mediates an allele specific upregulation of the clusterin mRNA.
25051234 These findings suggest that an intracellular form CLU and BIN1 interaction might impact Tau function in neurons and uncover potential new mechanisms underlying the etiology of Tau pathology in in Alzheimer's disease.
24996046 ApoJ facilitates infectious HCV particle production via stabilization of core/NS5A, which might surround lipid droplets at the ER-Golgi membrane contact site.
24967550 Data provide new evidence for neurocognitive markers of CLU-related Alzheimers disease risk in young people; provide the first indication of a CLU genotype effect on cognitive performance
24958191 Its variants are not associated with southern Chinese patients with Alzheimer's disease
24947876 The results of this study showed significant association between rs2279590 polymorphism and AD in Asian population using additive and recessive models, respectively. We observed no significant heterogeneity between Asian and Caucasian populations.
24937130 ATM plays an important role in insulin-like growth factor 1 (IGF-1) expression, that in turn, regulates downstream secretory-clusterin induction during senescence.
24806679 CLU and ApoE Alzheimer risk variants had combined effects on both volumetric expansion and lateral ventricle surface morphology
24758255 The study suggests that CLU expression on carotid artery is affected by TNF-alpha, cigarette smoking confirming its association with oxidative and cellular stress and anti-platelet medication
24743338 Of those 394 variants, 34 showed strong evidence of regulatory function (RegulomeDB score <3), and only 3 of them were genome-wide significant SNPs (ZCWPW1/rs1476679, CLU/rs1532278 and ABCA7/rs3764650).
24696417 High clusterin expression is associated with bladder cancer.
24660791 physical activity attenuated the effects of genetic risk (ie. the constellation of PICALM, BIN1, and CLU polymorphisms) on episodic memory
24599003 Results show that that nuclear CLU expression is regulated by direct binding of HIF-1alpha to hypoxia response elements sites and is epigenetically controlled by methylation of its promoter region.
24578178 PICALM and CLU risk genotypes exert differential impacts on the hippocampal resting-state functional connectivity in healthy young subjects.
24491388 Insulin-like growth factor-I induces CLU expression through Twist1 to promote prostate cancer growth.
24477687 Suggest Clu is required for renal tissue regeneration in the kidney repair phase after ischemia-reperfusion injury, which is associated with promotion of tubular cell proliferation.
24428970 Clusterin may be a biomarker of asthma severity and the burden of oxidative stress in patients with asthma. Moreover, clusterin may be useful for the prompt assessment of airway inflammation.
24407433 Clusterin is expressed in an enhanced and exaggerated pericanalicular pattern in the majority of hepatocellular carcinomas, which is not observed in benign liver nodular lesions.
24388797 This study demonstrated combined influence of APOE and CLU genotype on brain activity long before frank AD symptoms arise, and indicate executive attention as a neural marker of AD genetic risk in young people.
24378367 In nondemented older individuals, amyloid-Beta-associated volume loss occurs in the presence of elevated clusterin.
24334140 Far-infrared radiation inhibits the proliferation, migration, and angiogenesis of human umbilical endothelial cells, via decreasing secretory CLU.
24327270 The CLU-1 isoform is the predominant growth-suppressive variant in head and neck squamous cell carcinoma and is targeted by miRNA-21.
24244428 CLU genetic variants associate with cognition in two cohorts, but the genetic effect of CLU seems to regress toward the mean when aging.
24217652 In testicular seminoma and normal testis, clusterin exists in its heterodimeric secretory isoform. Clusterin expression is significantly lower in testicular seminoma than in normal testis.
24117116 study examined control, mild cognitive impairment and Alzheimer disease subjects, finding that plasma CLU levels were influenced not only by AD, but also the transitional stage of MCI, while rs11136000 genotype influenced plasma CLU levels in controls
24085287 These data suggest that clusterin, found to be expressed in human retinoblastoma, may exert anti-apoptotic effects on cisplatin-induced apoptosis and prevent cell death.
24008723 Clusterin may regulate aggressive behavior of human clear renal carcinoma cells through modulating ERK1/2 signaling and MMP-9 expression.
23956692 Plasma clusterin concentration shows promise as a candidate biomarker for predicting IVIG resistance in patients with Kawasaki disease
23896217 The downregulation of clusterin expression may be the cause of the high sensitivity of testicular seminoma to radiotherapy and chemotherapy.
23892938 The effect of the CLU rs11136000 polymorphism on AD risk in Asian cohorts (Chinese, Japanese, and Korean) is consistent with the protective effect observed in Caucasian AD cohorts.
23816822 Podoplanin and clusterin are reliable markers of human synovium
23786771 When combined with MDV3100, CLU knockdown accelerated AR degradation.
23770713 Data suggest that Clusterin may represent a new target of therapy for pancreatic neuroendocrine tumors (PNETs).
23769013 Histidine triad nucleotide-binding protein 1, bifunctional aminoacyl-tRNA synthetase, and clusterin precursor protein may serve as potential biomarkers distinguishing type 2 diabetes mellitus patients from healthy controls.
23702390 Clusterin expression was shown to be a novel unfavorable prognostic factor in mycosis fungoides and Sezary syndrome.
23673647 The hypothalamic clusterin-low-density lipoprotein receptor-related protein-2 axis is a novel anorexigenic signalling pathway.
23650005 Genome-wide association studies found 3 new susceptibility loci for Alzheimer disease(AD): complement receptor 1,clusterin,and the phosphatidylinositol-binding clathrin assembly protein. These SNPS are not associated with AD in a Polish population.
23643458 The LOAD-protective CLU variant is associated with better logical memory endophenotypes in white subjects
23621580 We showed that TPM2, CLU, and COL4A6 mRNA levels are downregulated in prostate cancer.
23589125 a complex regulatory mechanism of the clusterin gene expression during the progression from normal to malignant cells and the specific alteration of the sCLU:nCLU isoforms ratio associated with the pathological stage
23573206 Single nucleotide polymorphisms in APOE-epsilon4, CLU and MS4A4A influence both Alzheimer disease risk and cerebrospinal fluid Amyloid-beta1-42 levels.
23538443 Human clusterin prevents induction of the intrinsic apoptosis pathway mediated the influenza virus nucleoprotein by binding to Bax and inhibiting its movement into the mitochondria.
23521156 Demonstration of a specific association between Abeta40 and clusterin in Alzheimer's disease brain.
23457489 Knockdown of GRP78 expression in CLU-HepG2 cells abrogated the protective role of CLU under endoplasmic reticulum stress condition.
23416242 Cytosolic CLU was prone to aggregation at peri-nuclear region of cells and induced cell death. Signal sequence is shown to be an important determinant for cytosolic CLU generation and aggregation.
23411014 Clusterin is implicated as a susceptibility gene for late-onset Alzheimer's disease in Han Chinese.
23279642 The results have demonstrated that sCLU contributes to OXA resistance by activating Akt pathway.
23276503 biomarker for fewer relapses and longer survival in patients in the early stage adenocarcinomas of the lung
23209684 plasma clusterin levels are mot elevated in patients with Alzheimer's disease
23208459 Increased clusterin expression is correlated with more aggressive biologic behavior in ovarian cancer
23201481 A mechanistic insight into the generation of a cytotoxic variant of intracellular clusterin the molecular pathogenesis of diseases associated with chronic endoplasmic reticulum stress, such as neurodegeneration.
23174100 Data suggest that up-regulation of secretory CLU activates nuclear factor kappa B resulting in resistance of breast cancer cells to apoptosis by activation of tumor necrosis factor-alpha and up-regulation of Bcl-2 (bcl-2 proto-oncogene protein).
23099883 Data suggest that knocking-down clusterin/apolipoprotein J (Clu) gene expression may provide a valuable method for breast cancer therapy.
23051594 gonadotroph tumor cell proliferation is determined by the interplay between cell-specific FOXL2 with PTTG and Clusterin
23010347 Secretory clusterin may promote hepatocellular carcinoma metastasis via the induction of the epithelial-mesenchymal transition process.
22981431 Misfolded immunoglobulin light chain proteins induced endothelial cell death and dysfunction while reducing clusterin protein/gene expression and secretion in LC amyloidosis. Exogenous clusterin attenuated LC toxicity.
22975582 sCLU plays a positive role in non-small cell lung cancer cell proliferation, which may be mediated by the PI3K/AKT signaling pathway.
22952074 CLU and CR1 were associated with more rapid cognitive decline. PICALM was associated with an earlier age at midpoint of cognitive decline.
22949882 High clusterin expression is associated with hepatocellular carcinoma invasion.
22906254 Mass spectrometry quantifications in the frontal cortex demonstrated significantly higher level of clusterin in severe AD group in comparison to control group.
22902018 Clusterin gene expression was significantly increased in the semen samples of infertile men.
22896337 findings indicate that CLU is an important mediator of TGF-beta-induced EMT, and suggest that CLU suppression may represent a promising therapeutic option for suppressing prostate cancer metastatic progression
22889670 2D-gel electrophoresis analysis of cerebrospinal fluid reveals a two-fold increase in Parkinson's disease clusterin, compared to the normal control cohort.
22795969 The Alzheimer disease risk variant CLU influences longitudinal changes in brain function in asymptomatic individuals and is associated with faster cognitive decline in presymptomatic stages of disease progression.
22701550 Higher plasma ApoJ levels predicted white matter atrophy over two years in a cohort of older individuals with Mild Cognitive Impairment.
22689054 interactions between GRP78 and CLU under endoplasmic reticulum stress conditions that govern CLU trafficking and redistribution to the mitochondria, elucidating how GRP78 and CLU cooperatively promote survival during treatment stress in prostate cancer
22647452 there is a high level of clusterin immunolabeling and sperm DNA damage levels in hypertensive men compared with controls
22617144 [review] This critical overview provides the most recent data on involvement of clusterin in neurodegenerative diseases, with special reference to putative clinically relevant targets.
22613415 CLU may regulate the aggressive behaviour of human breast cancer cells through modulation of ERK signalling and MMP9 expression.
22569264 Data suggest that clusterin increases stability of cathepsin K in dilute/concentrated solutions; clusterin prevents substrate inhibition of cathepsin K; kinetic measurements show that clusterin binds cathepsin K with high affinity.
22545109 GPR39 activation increased the expression of the anti-apoptotic protein clusterin in butyrate-treated cells.
22539578 The SNP genotype pattern at the CLU gene is associated with episodic memory.
22506010 The AD-protective minor rs11136000T allele is associated with increased clusterin expression.
22465014 these results suggest that a disulfide-linked form of clusterin functions as an antioxidant protein via its cysteine sulfhydryl groups to reduce ROS levels and delay the organismal aging in fruit flies.
22402018 In conclusion, we confirmed association of CLU, CR1, and PICALM genes with the disease status in our cohort through identification of a number of disease-specific variants
22391565 Secretory CLU expression was stimulated by insulin-like growth factor-1, but suppressed by p53.
22296908 Clusterin (rs11136000) was associated with Alzheimer's disease in Chinese Han population.
22274961 This review discusses the genetic variation and role of the clusterin gene in Alzheimer's disease pathogenesis.
22266332 Data suggest that the effect of sex steroid deprivation appeared specific to clusterin associated with high density lipoproteins (HDL).
22258514 This study indicates that the rs9331888 AD-risk variant is associated with low blood clusterin levels.
22248099 The clusterin gene CLU is a genetic risk association of AD with rare coding CLU variations.
22236192 study found a 1.9-fold increase in the average levels of serum CLU in colorectal cancer patients compared to healthy donors
22234156 variation in CLU, genes are associated with Fuchs' endothelial dystrophy in Caucasian Australian cases
22232000 This study showed that overall levels of clusterinmRNA and protein areunchanged in Alzheimer's disease.
22179788 Data show that clusterin is able to influence both the aggregation and disaggregation of amyloid-beta(1-40) peptide by sequestration of the amyloid beta oligomers.
22166956 CLU downregulation in fibroblast-like synoviocytes alters their aggressiveness in rheumatoid arthritis synovitis.
22159129 Healthy carriers of the CLU variant exhibit altered coupling between hippocampus and prefrontal cortex during memory processing.
22130675 Clusterin and COMMD1 independently regulate degradation of the mammalian copper ATPases ATP7A and ATP7B.
22122982 The rs11136000 and rs9331888 polymorphisms of the CLU gene are associated with late-onset Alzheimer's disease
22082661 We observed increased clusterin expression in human familial amyloid polyneuropathy nerves.
22068036 determined that the tumor suppressors CLU, NGFR, and RUNX3 were also directly repressed by EZH2 like CASZ1 in NB cells
22016805 secretory Apolipoprotein J/Clus represents a pro-survival factor acting for the postponement of the untimely clearance of RBCs
22015308 findings showed evidence of CR1, CLU, and PICALM and late-onset Alzheimer's disease (LOAD) susceptibility in an independent southern Chinese population
22013110 Semen clusterin bears a set of complex glycans with high affinity for dendritic cell-specific ICAM-3-grabbing nonintegrin (DC-SIGN); these glycans mediate the effective binding of semen clusterin to DC-SIGN and interfere with HIV-1 binding to DC-SIGN.
22012253 Localisation is key for CLU physiology, explaining the wide range of effects in cell survival and transformation.
21998749 sCLU at the mature RBCs is an active component being functionally implicated in the signalling mechanisms of cellular senescence and oxidative stress-responses
21987172 these data indicate that YB-1 transactivation of clusterin in response to stress is a critical mediator of paclitaxel resistance in prostate cancer.
21980627 The overexpression of CLU in various stages of cervical lesions may serve as a potential marker to distinguish cervical neoplasia with borderline morphology features.
21953454 CRM1 protein-mediated regulation of nuclear clusterin (nCLU), an ionizing radiation-stimulated, Bax-dependent pro-death factor
21953030 report abundance levels of CLI in serum samples from patients with advanced breast cancer, colorectal cancer (CRC) and lung cancer compared to healthy controls (age and gender matched) using commercially available enzyme-linked immunosorbent assay kits
21912625 relationship of Parkinson's disease with SNPs of CLU, CR1 and PICALM
21900379 We report for the first time that circulating clusterin does not have a day/night variation pattern in healthy young individuals. Clusterin levels are associated with total and low-density lipoprotein cholesterol cross-sectionally.
21899841 Proteomic analysis of intra-arterial thrombus secretions reveals a negative association of clusterin and thrombospondin-1 with abdominal aortic aneurysm.
21892414 Results suggest a biological mechanism for the genetic association of CLU with Alzheimer's Disease risk and indicate that rs9331888 is one of the functional DNA variants underlying this association.
21824521 Our findings suggest that clusterin is associated with rate of brain atrophy in mild cognitive impairment
21761117 controversial data on CLU function in chemo-response/resistance may be explained by a shift in the pattern of CLU expression and intracellular localization as well when tumor acquires chemoresistance
21732348 Results identify clusterin (CLU) as a MDA-7/IL-24 interacting protein in DU-145 cells and investigate the role of MDA-7/IL-24 in regulating CLU expression and mediating the antitumor properties of mda-7/IL-24 in prostate cancer.
21633299 CLU could be a new molecular marker to predict overall survival of patients with advanced-stage cervical cancer treated with curative intended radiotherapy.
21630085 results indicated lower metastatic potential for lung cancer cells with high CLU level
21573492 nCLU also exerts a strong anti-migratory/anti-invasive activity in prostate cancer cells, by interfering with the cytoskeletal components and by decreasing MMP-2 activity.
21567405 Nuclear CLU sequesters Bcl-XL via a putative motif in the C-terminal coiled coil (CC2) domain, releasing Bax, and promoting apoptosis.
21543606 Young healthy carriers of the CLU gene risk variant showed a distinct profile of lower white matter integrity that may increase vulnerability to developing Alzheimer disease later in life.
21527247 these results suggest a molecular basis for the pro-apoptotic function of nCLU by elucidating the residue specific interactions of the BH3 motif in nCLU with anti-apoptotic Bcl-2 family proteins.
21525168 The proteomes of the type-1 diabetic, type-2 diabetic, and non-diabetic obese patients presented elevated amounts of the same set of one molecular form of semenogelin-1, one form of clusterin, and two forms of lactotransferrin.
21508640 The APOJ single nucleotide polymorphism (1598delT) is associated with risk factors for coronary artery disease in a Chinese population.
21505792 The chaperone clusterin mediates systemic clearance of misfolded extracellular proteins
21467285 data from the general population show that increased plasma clusterin levels are associated with prevalent alzheimer's disease (AD) and are higher in more severe cases of AD
21467232 Glycosylated serum Apo-J is associated with hepatocellular carcinoma.
21460853 these results integrate DNA damage resulting from genetic instability, IR, or chemotherapeutic agents, to ATM activation and abrogation of p53/NF-YA-mediated IGF-1 transcriptional repression, that induces IGF-1-sCLU expression.
21447104 No association found between CLU gene and Alzheimer's disease in a Japanese population
21422520 The results of this study concluded that the rs11136000 AD-risk variant is associated with low clusterin plasma levels in Alzheimer's disease.
21397462 Participants with the clusterin risk genotype have higher brain activity than participants with the protective allele in frontal and posterior cingulate cortex and the hippocampus, particularly during high memory demand.
21379329 There was evidence of association for recently-reported late-onset Alzheimer's disease risk loci, including BIN1 and CLU and CUGBP2 with APOE.
21347408 variants in BIN1, CLU, CR1 or PICALM are associated with changes in the CSF levels of biomarkers
21300948 This study provides compelling independent evidence that genetic variants in CLU, CR1, and PICALM are genetically associated with risk for AD.
21280673 Results suggest that serum clusterin is not an early, presymptomatic biomarker for Alzheimer's disease.
21242307 Clusterin (apolipoprotein J), a molecular chaperone that facilitates degradation of the copper-ATPases ATP7A and ATP7B.
21240462 Increase in clusterin forms part of the stress response in Hodgkin's lymphoma.
21224044 these results suggest that CLU may play a pathogenetic role in transthyretin and Ig light chain amyloidoses and amyloidotic cardiomyopathy.
21135756 Results do not support a role for plasma clusterin as an important leptin-binding protein or modulator of leptin action.
21059989 clu polymorphisms were associated with late-onset Alzheimer disease in an independent cohort from the National Institute on Aging Late-Onset Alzheimer's Disease Family Study
21059989 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
21043527 Serum ApoJ levels, determined by a commercial ELISA, were significantly lower in AMI-patients immediately after the event than in controls. In 60% of patients, the lowest ApoJ level was detected within 6 h after the onset of AMI.
21042904 In neuroblastoma, clusterin exerts its anti-apoptotic effects downstream of Ku70 acetylation, likely by directly blocking Bax activation.
20930273 This study demonistrated that late onset alzheimer's disease linke to 8p21.1 region Including the CLU gene.
20873220 Analysis of clusterin gene (CLU/APOJ) polymorphism in Alzheimer's disease patients and in normal cohorts from Russian populations
20873220 Observational study of gene-disease association. (HuGE Navigator)
20855565 Observational study of gene-disease association. (HuGE Navigator)
20850846 The CLU gene was associated with diabetes, probably through an increase in insulin resistance primarily and through an impairment of insulin secretion secondarily
20850846 Observational study of gene-disease association. (HuGE Navigator)
20847305 Clusterin levels in HDL are lower in men with reduced insulin sensitivity, higher body mass index, and an unfavorable lipid profile. Clusterin depletion contributes to the loss of HDL's cardioprotective properties.
20842452 The interaction between GOLPH2 and secretory CLU was confirmed intracellularly and extracellularly.
20739100 Observational study of gene-disease association. (HuGE Navigator)
20738160 Polymorphism of the clusterin gene may confer symptomatic specificity in schizophrenia, whereas polymorphism of the clathrin assembly lymphoid myeloid gene does not affect susceptibility to schizophrenia.
20738160 Observational study of gene-disease association. (HuGE Navigator)
20697030 This study confirmed in a completely independent data set that CR1, CLU, and PICALM are AD susceptibility loci in European ancestry populations.
20697030 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20674675 In this review, clusterin is a major Alzheimer's disease susceptibility gene implicated indirectly in the life cycle of the herpes simplex virus.
20614220 both cytoplasmic and nuclear immunostaining patterns of clusterin were detected in the tumors of patients with non-small cell lung cancer.
20603455 results demonstrate an important role of clusterin in the pathogenesis of Alzheimer disease (AD) and suggest that alterations in amyloid chaperone proteins may be a biologically relevant peripheral signature of AD
20599866 The minor allele (G) of the rs9331888 polymorphism within CLU was significantly associated with an increased risk of sporadic late-onset Alzheimer's disease in Chinese
20599866 Observational study of gene-disease association. (HuGE Navigator)
20570404 While no Alzheimer disease association is observed with single nucleotide polymorphisms, a trend of association is seen with Picalm and clusterin single nucleotide polymorphisms.
20570404 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20554627 These results show near-perfect replication and provide the first additional evidence that CLU is associated with the risk of late onset alzheimer disease.
20554627 Observational study of gene-disease association. (HuGE Navigator)
20534741 Data confirmed genetic associations for Alzheimer's disease with APOE, CLU, PICALM and CR1 SNPs.
20534741 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20497247 Clusterin expression may have a role in colonic carcinogenesis
20460622 Observational study, meta-analysis, and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20410100 SNPs in APOJ show strong statistical evidence of a functional effect on plasma fatty acid distribution.
20410100 Observational study of gene-disease association. (HuGE Navigator)
20353268 Overexpression of cytoplasmic clusterin seems to be related with patient's shorter survival in late stage gastric carcinoma.
20209083 CLU genetic variants may have a role in Alzheimer's disease
20209083 Observational study of gene-disease association. (HuGE Navigator)
20096688 Chibby and clusterin were co-immunoprecipitated with NBPF1.
20068069 Elevated levels of sCLU promote prostate cancer cell survival by facilitating degradation of COMMD1 and I-kappaB, thereby activating the canonical NF-kappaB pathway.
20058210 clusterin expression could be a new molecular marker to predict response to platinum-based chemotherapy and survival of patients with cervical cancer treated with neoadjuvant chemotherapy and radical hysterectomy.
20057494 Clu showed genome wide significant association with Alzheimer disease.
20028970 Data demonstrate that it is the presecretory form of CLU that has regulatory activity on NF-kappaB. Results identified the site of psCLU that interacts with IkappaB-alpha, and also showed that this region bears the regulatory activity of psCLU on NF-kappaB.
20019877 Clusterin may protect human corneal endothelial cells from oxidative injury-mediated cell death via inhibition of reactive oxygen species production.
20009887 Overexpression of clusterin is associated with ovarian cancer.
20007348 Reduction of inducible expression of clusterin results in an increase in tubular cell apoptosis and renders mice prone to ischemia reperfusion injury, implying a protective role of clusterin in kidney injury.
19996109 The chaperone action of clusterin protects major human plasma proteins from aggregation and precipitation
19996109 Data identified ceruloplasmin, fibrinogen, and albumin as major clients for clusterin.
19940549 Data show that clusterin expression is under epigenetic control via methylation of its promoter.
19935703 a role for secreted clusterin as an important extracellular promoter of epithelial-to-mesenchymal transition
19903745 CLU acts as a tumor suppressor in the early stages of carcinogenesis, but CLU may also represent a pro-survival stimulus confering increased resistance to anti-cancer drugs or enhancing tumour cell survival in specific niches. Review.
19903339 microarray study in sinonasal adenocarcinoma we identified proteins, CLU that is significantly differentially expressed in tumors compared to normal tissue
19879423 In early-stage lung cancers CLU represents a positive biomarker correlating with better overall survival.[Review]
19879422 reports the dynamic interaction of the different forms of CLU with their partners DNA-repair protein Ku70 and proapoptotic factor Bax during colon cancer progression, which seems to be a crucial point for the neoplastic cell fate.[Review]
19879421 CLU expression has contradictory functions, including cell survival, tumor progression, and apoptosis; these ambiguous functions are due to 2 different but related CLU protein forms, a glycosylated and a nonglycosylated form [Review]
19879420 This data suggest the importance of epigenetic events in the regulation of CLU in prostate cancer, supporting the idea that prostate cell transformation at early stages requires CLU silencing through chromatin remodeling.[Review]
19878774 The chaperone action of clusterin is important in quality control of extracellular protein folding
19878569 Observational study of gene-disease association. (HuGE Navigator)
19814590 The secretion of the potential zonal marker clusterin by zonal articular chondrocytes in osteoarthritic and healthy articular cartilage, was characterized.
19793084 Clusterin as a predictor for chemoradiotherapy sensitivity and patient survival in esophageal squamous cell carcinoma.
19757199 Clusterin may be considered as a potential diagnostic and prognostic biomarker for bladder cancer
19734903 Two loci gave replicated evidence of association with Alzheimer's disease: one within CLU on chromosome 8 and the other within CR1 on chromosome 1.
19734903 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19734902 Having removed Single Nucleotide Polymorphism within the APOE, CLU and PICALM loci from the analysis, focused on those that showed the most evidence for association with Alzheimer's disease
19734902 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19664600 clusterin strongly interacts with wild-type transthyretin (TTR) and TTR variants V30M and L55P under acidic conditions, and blocks the amyloid fibril formation of TTR variants.
19651157 Reviews the literature linking clusterin to Alzheimer disease (AD). Clusterin can be viewed as a multipotent guardian of brain but is unable to prevent the progressive neuropathology in chronic AD.
19542874 Clusterin is a highly sensitive marker for tenosynovial giant cell tumors
19535339 Clusterin forms very large, soluble chaperone-client complexes
19535339 analysis of clusterin-chaperone client protein complexes
19446882 A novel heterozygous mutation in the clusterin gene, nucleotide position A1298C (glutamine>proline Q433P), was detected in exon 7 of a child with recurrent hemolytic uremic syndrome. The same mutation was found in the child's two siblings and mother.
19413638 Clusterin may protect bile duct epithelium against offensive biliary components or inhibit precipitation of biliary proteins
19391138 High clusterin gene expression is associated with disease progression, chemoresistance and metastasis of ovarian cancer.
19357365 Clusterin facilitates exchange of glycosyl phosphatidylinositol-linked SPAM1 between reproductive luminal fluids and mouse and human sperm membranes.
19353783 upregulated after proteasome inhibition due to transactivation by heat-shock factor-1 and due to accumulatioin as a result of reduced proteasomal protein degradation
19344414 Observational study of gene-disease association. (HuGE Navigator)
19289586 Clusterin expression was not specific for Mycosis fungoides
19264665 These data indicated that hepatitis delta virus-induced clusterin protein increases cell survival potential.
19220628 Clusterin expression in cutaneous CD30-positive lymphoproliferative disorders and their histologic simulants.
19182256 Observational study of gene-disease association. (HuGE Navigator)
19177010 Data suggest that Ku70-Bax-clusterin interactions in human colon cancer are modulated by IL-6 that influences Bax-dependent cell death increasing Ku70 binding to Bax and influencing sCLU production that promotes tumor cell survival.
19166932 Clusterin-rich cells displayed a spindle-shape morphology while those with low clusterin levels were cuboidal in shape prompted us to investigate if clusterin modulates epithelial-to-mesenchymal transitions.
19165232 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19137541 Results suggest that proteasome inhibition may induce prostate cancer cell death through accumulation of n-clusterin, a potential tumor suppressor factor.
19118032 We suggest that elevated sCLU levels may enhance tumorigenesis by interfering with Bax proapoptotic activities and contribute to one of the major characteristics of cancer cells, that is, resistance to apoptosis.
18842294 Observational study of gene-disease association. (HuGE Navigator)
18813793 basal clusterin levels are higher in antiestrogen resistant cells; it is up-regulated following antiestrogen treatment; and down-regulation of cytoplasmic clusterin restores sensitivity to toremifene in the antiestrogen-resistant cell line
18806885 Clusterin is present in ocular anterior segment tissues involved in pseudoexfoliation syndrome.
18806885 Observational study of gene-disease association. (HuGE Navigator)
18786636 Results identified an interaction between prion protein and clusterin, a chaperone glycoprotein.
18714397 The chaperone clusterin can protect ovarian cancer cells by sequestering the chemotherapeutic drug paclitaxel
18714397 clusterin is a potential therapeutic target for enhancing chemoresponsiveness in patients with a high-level clusterin expression
18712185 ApoJ and leptin may have roles in coronary heart disease
18709641 the 4 biomarkers CLU, ITGB3, PRAME and CAPG may be used as prognostic factors for patients with stage III serous ovarian adenocarcinomas.
18649357 Together with known function of clusterin, the data suggest an epigenetic component in the regulation of clusterin in prostate cancer
18612545 In atherosclerotic lesions, ApoJ may have protective functions through its capacity to inactivate C5b-9 complement complexes and by reducing the cytotoxic effects of modified LDL on cells that gain contact with the lipoprotein.
18542050 TRPM2-mediated Ca2+influx induces chemokine production in monocytes that aggravates inflammatory neutrophil infiltration.
18514801 Data suggest that clusterin expression is related to endometrioid carcinoma of endometrium, in which estrogen is involved in the regulatory network of clusterin.
18458059 The interplay between cancer cell-derived clusterin and IGF-1 may dictate the outcome of cell growth and dormancy during tumorigenic progression.
18378577 Clusterin is markedly elevated in Fuchs' endothelial dystrophy(FED)-affected tissue, pointing to a yet undiscovered form of dysregulation of endothelial cell function involved in FED pathogenesis.
18239862 Clusterin expression is found nn pituitary adenoma and in non-neoplastic non-neoplastic adenohypophyses.
18097679 clusterin is expressed in M cells and follicular dendritic cells at inductive sites of human mucosa-associated lymphoid tissue suggesting a role for this protein in innate immune responses
18082619 These findings suggest that CLU regulates TGF-beta signaling pathway by modulating the stability of Smad2/3 proteins.
18079682 Clusterin shows possible important functions in tumor suppression by the von Hippel-Lindau disease (VHL) gene product. May provide better understanding of retinal hemangioblastoma associated with VHL disease.
17974975 CLU gene expression might play a crucial role in prostate tumorigenesis by exerting differential biological effects on normal versus tumor cells through differential processing of CLU isoforms in the two cell systems.
17872975 Clusterin is constantly associated with altered elastic fibers in aged human skin. Clusterin exerted a chaperone-like activity and effectively inhibited UV-induced aggregation of elastin.
17855704 may be a biomarker for longer survival in patients with surgically resected non-small cell lung cancer
17689225 Hyper-expressed form of clusterin localizes to mitochondria, inhibits cytochrome c release, and is inhibited by the proteasome.
17535098 CLU was identified as a useful tumor marker for the diagnosis of pediatric large cell lymphoma.
17534116 The expression and subcellular localization of Clusterin in the nucleus demonstrated the involvement of this protein in the photo-oxidative cell death pathway.
17512083 Clusterin induces remarkable differentiation of the functional beta cells secreting insulin in response to glucose stimulation.
17451556 The extracellular chaperone clusterin appears in the cytosol during endoplasmic stress
17451556 Under certain stress conditions, clusterin can evade the secretion pathway and reach the cytosol, and the retrotranslocation of clusterin is likely to occur through a mechanism similar to the ER-associated protein degradation pathway and involves Golgi.
17420006 Our results indicate that epigenetic factors regulate the clusterin expression of RPE cells and thus might affect the pathogenesis of AMD via the inhibition of angiogenesis and inflammation.
17412999 The chaperone action of clusterin can inhibit amyloid formation and toxicity
17412999 Clusterin is an important element in the control of extracellular protein misfolding and in the formation of neurofibrillary tangles.
17407782 The chaperone action of clusterin targets prefibrillar species to inhibit amyloid formation by lysozyme
17322305 Clusterin expression is associated with neuroendocrine differentiation in normal epithelia and that the Clusterin observed in neoplastic cells is de novo synthesized.
17260971 Glycosylation is not essential for the chaperone action of clusterin
17260971 deglycosylation of clusterin had little effect on secondary structure content but produced a small increase in solvent-exposed hydrophobicity and enhanced aggregation. These changes were associated with increased binding to a variety of ligands
17224269 expression of sCLU modulates growth regulatory effects of 1,25(OH)(2)D(3) in prostate cancer
17203891 CLU immunoreactivity may be helpful as a supplementary criterion to better assess the tumors propensity to relapse in breast carcinoma.
17148459 Clusterin mRNA and protein are shown to increase with androgen treatment in a time- and dose-dependent manner
17080454 low-power 60 GHz radiation does not modify stress-sensitive gene expression of chaperone proteins.
17056579 In rheumatoid arthritis joints, high levels of extracellular CLU and low expression of intracellular CLU may enhance NF-kappaB activation and survival of the synoviocytes.
17048076 This review summarizes our current understanding of the role of clusterin in DNA repair, apoptosis, and cell cycle control and the relevance.
16955214 CLU is actively involved in both replicative senescence and terminal differentiation in different types of human haematopoietic cells.
16775601 Binding of clusterin to the LDL-R might offer an interpretative key for the pathogenesis of membranous glomerulonephritis in humans
16709934 clusterin may have a protective effect against cigarette smoke-induced oxidative stress in lung fibroblasts.
16709604 stem cell factor and clusterin may have roles in azoospermia
16675913 Clusterin and bcl-2 are upregulated in laryngeal carcinomas and their expression is related to invasiveness of these tumors.
16490286 The results show that clusterin is significantly increased in cerebrospinal fluid from Alzheimer patients as a group, supporting that clusterin might be involved in the pathogenesis of Alzheimer's disease.
16464517 following exposure to sub-lethal amounts of iron-ascorbate to induce an increase in reactive oxygen species generation and lipid peroxidation, a time-dependent up-regulation of clusterin protein and mRNA levels was observed in neuroblastoma cells
16331665 CLU expression/sub-cellular localization is strictly related to cell fate.
16179938 the importance of CLU in various physiological functions including tumour growth--review
16113678 Taken together, our results suggest that the elevated level of clusterin in human cancers may promote oncogenic transformation and tumour progression by interfering with Bax pro-apoptotic activities.
15955107 Clusterin is strongly expressed in melanoma. Downregulation of clusterin reduces drug-resistance, i.e., reduces melanoma cell survival in response to cytotoxic drugs. Reducing clusterin may be novel tool to overcome drug-resistance in melanoma.
15929184 overexpression of cytoplasmic clusterin might be involved in the tumorigenesis and/or progression of colorctal cancers
15925890 Observational study of gene-disease association. (HuGE Navigator)
15925890 The 866C-->T polymorphism might be associated with preeclampsia and essential hypertension.
15883054 Observational study of gene-disease association. (HuGE Navigator)
15809754 Antisense oligonucleotide treatment may improve the outcome of radiation therapy for patients with bladder cancer.
15791650 Clusterin mRNA is increased twofold in early exponential phase of cell proliferation followed by downregulation in the subsequent quiescence phase, whereas it is rapidly increased up to twelvefold upon UV-induced apoptosis.
15689620 Data show that ionizing radiation causes stress-induced activation of insulin-like growth factor-1 receptor-Src-Mek-Erk-Egr-1 signaling that regulates the clusterin pro-survival cascade.
15649646 CLU may become highly cytostatic and/or cytotoxic if it accumulates intracellularly in high amounts
15591223 The role of clusterin & its isoforms in SMC behavior is complex & chronologically regulated in response to microenvironmental changes. Proliferative arrest reduces s-CLU; apoptosis increases n-CLU.
15538973 The Ectopic overexpression of the secreted form of clusterin/apoliporotein J the sensitivity of HaCaT cells to toxic effects of ropivacaine as demonstrated by DNA fragmentation.
15499376 Calcium deprivation causes translocation of a 45kDa CLU isoform to the nucleus in human prostate epithelial cells, leading to inhibition of cell proliferation and caspase-cascade-dependent anoikis.
15492264 Nuclear clusterin function is proapoptotic in colon cancer when induced by APC or chemotherapy in the context of p21 expression.
15389725 findings suggest that clusterin may contribute to conferring resistance to oxidative stress-mediated cellular injury on prostate cancer cells, especially in the presence of androgen
15304052 platelet ADP receptor P2Y(12) and clusterin are downregulated in patients with systemic lupus erythematosus
15252304 Clusterin staining supports a diagnosis of follicular dendritic cell tumor and helps classify them.
15247015 although CLU is essential for cellular homeostasis, it may become highly cytotoxic in certain cellular contexts when it accumulates in high amounts intracellularly either by direct synthesis or by uptake from the extracellular milieu
15158456 clusterin is involved in 15d-PGJ(2)-induced nodule formation and cell differentiation in vascular smooth muscle cells
15133840 Data suggest that the N-terminal deletion of clusterin may be essential for its alterations of biogenesis in esophageal squamous cell carcinoma.
15033782 Clusterin is downregulated during prostate cancer onset and progression, and its upregulation has inhibited DNA synthesis and cell cycle progression.
14618611 Clusterin is downregulated in CaP in comparison with matched benign controls
12882985 apolipoprotein J has a role in inhibiting NF-kappaB signaling through stabilization of IkappaBs; this activity may result in suppression of tumor cell motility
12860995 clusterin may act as a negative regulator of MT6-MMP in vivo
12679903 Loss of this protein both in serum and tissue correlates with the tumorigenesis of esophageal squamous cell carcinoma via proteomics approaches.
12551933 synthesis and functional analysis
12429802 Authors conclude that clusterin is a marker of anaplastic large cell lymphoma and that addition of clusterin to antibody panels designed to distinguish systemic anaplastic large cell lymphoma from classical Hodgkin's disease is useful.
12427144 The overall pool of clusterin is reduced in glomerular diseases causing nephrotic syndrome, with hypercholesterolemia appearing as the unifying feature
12200037 role during cellular senescence and tumorigenesis [review]
12176985 Low pH activates the chaperone action of clusterin
12176985 clusterin is activated in reduced pH
12172907 clusterin may modify the formation of alpha-synuclein-positive inclusion bodies such as Lewy bodies and GCIs, through a previously proposed chaperone property of clusterin
12082621 Clusterin (SGP-2) transient overexpression decreases proliferation rate of SV40-immortalized human prostate epithelial cells by slowing down cell cycle progression.
11904161 The chaperone action of clusterin targets slowly aggregating proteins
11892985 Apo J senescence-related overexpression is proposed to have antiapoptotic rather than antiproliferative effects.
11813210 expression increases early after androgen withdrawal in prostate cancer; protects tumor cells from apoptosis induced by medical castration
11714447 Introduction of clusterin gene into human renal cell carcinoma cells enhances their resistance to cytotoxic chemotherapy through inhibition of apoptosis both in vitro and in vivo
11123922 The chaperone action of clusterin is ATP-independent
10694874 Clusterin has a chaperone action like that of the small heat shock proteins
10066740 Clusterin is a holdase-type extracellular chaperone

AA Sequence

MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTL      1 - 70
LSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQL     71 - 140
EEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFS    141 - 210
LPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDD    211 - 280
DRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQW    281 - 350
KMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVP    351 - 420
VEVSRKNPKFMETVAEKALQEYRKKHREE                                             421 - 449
//

Text Mined References (406)

PMID Year Title
26884339 2016 Clusterin Binds to A?1-42 Oligomers with High Affinity and Interferes with Peptide Aggregation by Inhibiting Primary and Secondary Nucleation.
26826245 2016 Clusterin Modulates Allergic Airway Inflammation by Attenuating CCL20-Mediated Dendritic Cell Recruitment.
26810527 2016 Clusterin CSF levels in differential diagnosis of neurodegenerative disorders.
26757186 2016 Lower Prevalence of Alzheimer's Disease among Tibetans: Association with Religious and Genetic Factors.
26738351 2015 Association of CLU and TLR2 gene polymorphisms with late-onset Alzheimer disease in a northwestern Iranian population.
26683597 2016 Elevated Expression of the Cerebrospinal Fluid Disease Markers Chromogranin A and Clusterin in Astrocytes of Multiple Sclerosis White Matter Lesions.
26673020 2016 The CLU-files: disentanglement of a mystery.
26545630 2016 A potential endophenotype for Alzheimer's disease: cerebrospinal fluid clusterin.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26488311 2015 Glycosylation of Human Plasma Clusterin Yields a Novel Candidate Biomarker of Alzheimer's Disease.
26482819 2015 Increased extracellular clusterin in the prefrontal cortex in schizophrenia.
26449541 2016 Interaction between variants in CLU and MS4A4E modulates Alzheimer's disease risk.
26434199 2015 LACK OF ASSOCIATIONS BETWEEN CLU AND PICALM GENE POLYMORPHISMS AND ALZHEIMER'S DISEASE IN A TURKISH POPULATION.
26399194 2015 Clusterin, a gene enriched in intestinal stem cells, is required for L1-mediated colon cancer metastasis.
26368530 2015 Pseudomonas aeruginosa Uses Dihydrolipoamide Dehydrogenase (Lpd) to Bind to the Human Terminal Pathway Regulators Vitronectin and Clusterin to Inhibit Terminal Pathway Complement Attack.
26293319 2015 Lentivirus-mediated shRNA interference of clusterin blocks proliferation, motility, invasion and cell cycle in the ovarian cancer cells.
26179372 2015 Reduced secreted clusterin as a mechanism for Alzheimer-associated CLU mutations.
26159041 2015 Exosomal clusterin, identified in the pericardial fluid, improves myocardial performance following MI through epicardial activation, enhanced arteriogenesis and reduced apoptosis.
26081122 2015 Increased concentration of clusterin/apolipoprotein J (apoJ) in hyperlipemic serum is paradoxically associated with decreased apoJ content in lipoproteins.
25934174 2015 Clusterin transcript variants expression in thyroid tumor: a potential marker of malignancy?
25917404 2015 Clusterin gene is predominantly regulated by histone modifications in human colon cancer and ectopic expression of the nuclear isoform induces cell death.
25884382 2015 sCLU regulates cisplatin chemosensitivity of lung cancer cells in vivo.
25884309 2015 Plasma clusterin as a candidate pre-diagnosis marker of colorectal cancer risk in the Florence cohort of the European Prospective Investigation into Cancer and Nutrition: a pilot study.
25855029 2015 Clusterin glycopeptide variant characterization reveals significant site-specific glycan changes in the plasma of clear cell renal cell carcinoma.
25849827 2015 Evaluation of genetic polymorphisms in clusterin and tumor necrosis factor-alpha genes in South Indian individuals with pseudoexfoliation syndrome.
25703218 2015 Genetic associations of CLU rs9331888 polymorphism with Alzheimer's disease: A meta-analysis.
25609201 2015 Clusterin facilitates metastasis by EIF3I/Akt/MMP13 signaling in hepatocellular carcinoma.
25600802 2015 Silencing clusterin gene transcription on effects of multidrug resistance reversing of human hepatoma HepG2/ADM cells.
25574066 2014 Serum clusterin as a tumor marker and prognostic factor for patients with esophageal cancer.
25503391 2014 Clusterin facilitates stress-induced lipidation of LC3 and autophagosome biogenesis to enhance cancer cell survival.
25496871 2015 Alzheimer's disease risk variant in CLU is associated with neural inefficiency in healthy individuals.
25478940 2015 Cooperative stabilization of transthyretin by clusterin and diflunisal.
25464035 2015 Distinct promoters, subjected to epigenetic regulation, drive the expression of two clusterin mRNAs in prostate cancer cells.
25451228 2014 PACAP inhibits tumor growth and interferes with clusterin in cervical carcinomas.
25343293 2014 Knockdown of clusterin expression increases the in vitro sensitivity of human prostate cancer cells to paclitaxel.
25083615 2015 Clusterin in kidney transplantation: novel biomarkers versus serum creatinine for early prediction of delayed graft function.
25076422 2014 Plasma clusterin (ApoJ) levels are associated with adiposity and systemic inflammation.
25071085 2015 Inhibition of intracellular clusterin attenuates cell death in nephropathic cystinosis.
25057782 2014 Role of an extracellular chaperone, Clusterin in the pathogenesis of Pseudoexfoliation Syndrome and Pseudoexfoliation Glaucoma.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25051234 2014 Intracellular clusterin interacts with brain isoforms of the bridging integrator 1 and with the microtubule-associated protein Tau in Alzheimer's disease.
24996046 2014 Apolipoprotein J, a glucose-upregulated molecular chaperone, stabilizes core and NS5A to promote infectious hepatitis C virus virion production.
24967550 2014 A gene-brain-cognition pathway for the effect of an Alzheimer?s risk gene on working memory in young adults.
24958191 2014 Clusterin variants are not associated with southern Chinese patients with Alzheimer's disease.
24947876 2015 CLU rs2279590 polymorphism contributes to Alzheimer's disease susceptibility in Caucasian and Asian populations.
24937130 2014 ATM regulates insulin-like growth factor 1-secretory clusterin (IGF-1-sCLU) expression that protects cells against senescence.
24806679 2014 Combined effects of Alzheimer risk variants in the CLU and ApoE genes on ventricular expansion patterns in the elderly.
24758255 2014 Clusterin/Apolipoprotein J immunolocalization on carotid artery is affected by TNF-alpha, cigarette smoking and anti-platelet treatment.
24743338 2014 Connecting the dots: potential of data integration to identify regulatory SNPs in late-onset Alzheimer's disease GWAS findings.
24696417 2014 Diagnostic evaluation of urinary angiogenin (ANG) and clusterin (CLU) as biomarker for bladder cancer.
24660791 2014 The benefits of staying active in old age: physical activity counteracts the negative influence of PICALM, BIN1, and CLU risk alleles on episodic memory functioning.
24599003 2014 Hypoxia inducible factor-1? directly regulates nuclear clusterin transcription by interacting with hypoxia response elements in the clusterin promoter.
24578178 2015 Impacts of PICALM and CLU variants associated with Alzheimer's disease on the functional connectivity of the hippocampus in healthy young adults.
24491388 2014 Insulin-like growth factor-I induces CLU expression through Twist1 to promote prostate cancer growth.
24477687 2014 Promotion of cell proliferation by clusterin in the renal tissue repair phase after ischemia-reperfusion injury.
24446231 2014 Apolipoproteins E and J interfere with amyloid-beta uptake by primary human astrocytes and microglia in vitro.
24428970 2014 Clusterin expression level correlates with increased oxidative stress in asthmatics.
24407433 2014 Immunohistochemical stains of proliferating cell nuclear antigen, insulin-like growth factor 2 and clusterin help distinguish malignant from benign liver nodular lesions.
24388797 2014 A combined effect of two Alzheimer's risk genes on medial temporal activity during executive attention in young adults.
24378367 2014 The role of clusterin in amyloid-?-associated neurodegeneration.
24334140 2014 Far-infrared radiation inhibits proliferation, migration, and angiogenesis of human umbilical vein endothelial cells by suppressing secretory clusterin levels.
24327270 2014 Clusterin is a gene-specific target of microRNA-21 in head and neck squamous cell carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24244428 2013 CLU genetic variants and cognitive decline among elderly and oldest old.
24217652 2013 Downregulation of clusterin expression in human testicular seminoma.
24162737 2013 Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease.
24117116 2013 Plasma clusterin levels and the rs11136000 genotype in individuals with mild cognitive impairment and Alzheimer's disease.
24085287 2013 Anti-apoptotic effect of clusterin on cisplatin-induced cell death of retinoblastoma cells.
24073260 2013 Non-secreted clusterin isoforms are translated in rare amounts from distinct human mRNA variants and do not affect Bax-mediated apoptosis or the NF-?B signaling pathway.
24008723 2014 Clusterin plays an important role in clear renal cell cancer metastasis.
23956692 2013 Plasma clusterin concentrations may predict resistance to intravenous immunoglobulin in patients with Kawasaki disease.
23896217 2013 Clusterin expression and human testicular seminoma.
23892938 2014 The CLU gene rs11136000 variant is significantly associated with Alzheimer's disease in Caucasian and Asian populations.
23816822 2013 Podoplanin and clusterin are reliable markers of nonneoplastic synovium at various sites.
23786771 2013 Cotargeting Androgen Receptor and Clusterin Delays Castrate-Resistant Prostate Cancer Progression by Inhibiting Adaptive Stress Response and AR Stability.
23770713 2013 Cytoplasmic Clusterin expression correlates with pancreatic neuroendocrine tumor size and pathological stage.
23769013 2013 Identification of urinary biomarkers for type 2 diabetes using bead-based proteomic approach.
23702390 2013 Prognostic factors in 105 Japanese cases of mycosis fungoides and Sézary syndrome: clusterin expression as a novel prognostic factor.
23673647 2013 Clusterin and LRP2 are critical components of the hypothalamic feeding regulatory pathway.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
23650005 Lack of association of CR1, PICALM and CLU gene polymorphisms with Alzheimer disease in a Polish population.
23643458 2014 Evaluation of memory endophenotypes for association with CLU, CR1, and PICALM variants in black and white subjects.
23621580 2013 Identification of new genes downregulated in prostate cancer and investigation of their effects on prognosis.
23589125 2013 Regulation of the expression of CLU isoforms in endometrial proliferative diseases.
23573206 2013 Genetic loci associated with Alzheimer's disease and cerebrospinal fluid biomarkers in a Finnish case-control cohort.
23538443 2013 Influenza A virus nucleoprotein induces apoptosis in human airway epithelial cells: implications of a novel interaction between nucleoprotein and host protein Clusterin.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23521156 2013 Clusterin associates specifically with A?40 in Alzheimer's disease brain tissue.
23457489 2013 Clusterin protects hepatocellular carcinoma cells from endoplasmic reticulum stress induced apoptosis through GRP78.
23416242 2013 Cotransin induces accumulation of a cytotoxic clusterin variant that cotranslationally rerouted to the cytosol.
23411014 2013 Genetic variation in clusterin gene and Alzheimer's disease risk in Han Chinese.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23279642 2013 Secretory clusterin contributes to oxaliplatin resistance by activating Akt pathway in hepatocellular carcinoma.
23276503 2013 Prognostic role of clusterin in resected adenocarcinomas of the lung.
23209684 2012 No diagnostic value of plasma clusterin in Alzheimer's disease.
23208459 2013 Epigenetic and immunohistochemical characterization of the Clusterin gene in ovarian tumors.
23201481 2013 Unglycosylated clusterin variant accumulates in the endoplasmic reticulum and induces cytotoxicity.
23174100 2012 Clusterin confers resistance to TNF-alpha-induced apoptosis in breast cancer cells through NF-kappaB activation and Bcl-2 overexpression.
23099883 2012 Small interfering RNA targeted to secretory clusterin blocks tumor growth, motility, and invasion in breast cancer.
23051594 2012 Clusterin and FOXL2 act concordantly to regulate pituitary gonadotroph adenoma growth.
23010347 2012 Tumor-derived secretory clusterin induces epithelial-mesenchymal transition and facilitates hepatocellular carcinoma metastasis.
22981431 2012 Protective role of clusterin in preserving endothelial function in AL amyloidosis.
22975582 RNA interference-mediated secretory clusterin gene silencing inhibits proliferation and promotes apoptosis of human non-small cell lung cancer cells.
22952074 2012 Effect of Alzheimer's disease risk genes on trajectories of cognitive function in the Cardiovascular Health Study.
22949882 2012 Antisense oligonucleotide against clusterin regulates human hepatocellular carcinoma invasion through transcriptional regulation of matrix metalloproteinase-2 and E-cadherin.
22906254 2012 Mass spectrometry quantification of clusterin in the human brain.
22902018 2012 Seminal clusterin gene expression associated with seminal variables in fertile and infertile men.
22896337 2012 Clusterin mediates TGF-?-induced epithelial-mesenchymal transition and metastasis via Twist1 in prostate cancer cells.
22889670 2012 Cerebrospinal fluid biomarkers of neuropathologically diagnosed Parkinson's disease subjects.
22795969 2013 Alzheimer risk variant CLU and brain function during aging.
22701550 2012 Plasma apolipoprotein levels are associated with cognitive status and decline in a community cohort of older individuals.
22689054 2013 GRP78 regulates clusterin stability, retrotranslocation and mitochondrial localization under ER stress in prostate cancer.
22647452 2012 Higher clusterin immunolabeling and sperm DNA damage levels in hypertensive men compared with controls.
22617144 2012 Clusterin in neurological disorders: molecular perspectives and clinical relevance.
22613415 2012 Stable knockdown of clusterin by vectorbased RNA interference in a human breast cancer cell line inhibits tumour cell invasion and metastasis.
22569264 2012 Clusterin is a specific stabilizer and liberator of extracellular cathepsin K.
22545109 2012 Zinc sensing receptor signaling, mediated by GPR39, reduces butyrate-induced cell death in HT29 colonocytes via upregulation of clusterin.
22539578 2012 Genotype patterns at PICALM, CR1, BIN1, CLU, and APOE genes are associated with episodic memory.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22506010 2012 Genetics of clusterin isoform expression and Alzheimer's disease risk.
22465014 2012 Over-expression of human clusterin increases stress resistance and extends lifespan in Drosophila melanogaster.
22402018 2012 Implication of common and disease specific variants in CLU, CR1, and PICALM.
22391565 2013 Low dose IR-induced IGF-1-sCLU expression: a p53-repressed expression cascade that interferes with TGF?1 signaling to confer a pro-survival bystander effect.
22296908 2011 Association study of clusterin polymorphism rs11136000 with late onset Alzheimer's disease in Chinese Han population.
22274961 2012 The role of clusterin in Alzheimer's disease: pathways, pathogenesis, and therapy.
22266332 2012 Acute sex steroid withdrawal increases cholesterol efflux capacity and HDL-associated clusterin in men.
22258514 2012 Blood clusterin levels, rs9331888 polymorphism, and the risk of Alzheimer's disease.
22248099 2012 Both common variations and rare non-synonymous substitutions and small insertion/deletions in CLU are associated with increased Alzheimer risk.
22236192 2012 Secreted clusterin in colon tumor cell models and its potential as diagnostic marker for colorectal cancer.
22234156 2012 Association of TCF4 and CLU polymorphisms with Fuchs' endothelial dystrophy and implication of CLU and TGFBI proteins in the disease process.
22232000 2012 Clusterin mRNA and protein in Alzheimer's disease.
22179788 2011 The extracellular chaperone clusterin sequesters oligomeric forms of the amyloid-?(1-40) peptide.
22166956 2012 Implication of clusterin in TNF-? response of rheumatoid synovitis: lesson from in vitro knock-down of clusterin in human synovial fibroblast cells.
22159129 2011 Hippocampal function in healthy carriers of the CLU Alzheimer's disease risk variant.
22130675 2012 Clusterin and COMMD1 independently regulate degradation of the mammalian copper ATPases ATP7A and ATP7B.
22122982 2011 Association of clusterin gene polymorphisms with late-onset Alzheimer's disease.
22082661 2011 Clusterin overexpression and its possible protective role in transthyretin deposition in familial amyloidotic polyneuropathy.
22068036 2012 EZH2 Mediates epigenetic silencing of neuroblastoma suppressor genes CASZ1, CLU, RUNX3, and NGFR.
22016805 2011 Apolipoprotein J/clusterin in human erythrocytes is involved in the molecular process of defected material disposal during vesiculation.
22015308 2012 Polymorphisms of CR1, CLU and PICALM confer susceptibility of Alzheimer's disease in a southern Chinese population.
22013110 2011 Semen clusterin is a novel DC-SIGN ligand.
22012253 2011 The tumour-suppressive function of CLU is explained by its localisation and interaction with HSP60.
21998749 2011 Apolipoprotein J/Clusterin is a novel structural component of human erythrocytes and a biomarker of cellular stress and senescence.
21987172 2011 Clusterin is a critical downstream mediator of stress-induced YB-1 transactivation in prostate cancer.
21980627 2011 Clusterin as a potential marker in distinguishing cervical neoplasia.
21953454 2011 CRM1 protein-mediated regulation of nuclear clusterin (nCLU), an ionizing radiation-stimulated, Bax-dependent pro-death factor.
21953030 2012 Analysis of acute-phase proteins, AHSG, C3, CLI, HP and SAA, reveals distinctive expression patterns associated with breast, colorectal and lung cancer.
21912625 2011 An exploratory study on CLU, CR1 and PICALM and Parkinson disease.
21900379 2011 Circulating clusterin (apolipoprotein J) levels do not have any day/night variability and are positively associated with total and LDL cholesterol levels in young healthy individuals.
21899841 2011 Proteomic analysis of intra-arterial thrombus secretions reveals a negative association of clusterin and thrombospondin-1 with abdominal aortic aneurysm.
21892414 2011 Alzheimer's risk variants in the clusterin gene are associated with alternative splicing.
21824521 2012 Plasma clusterin concentration is associated with longitudinal brain atrophy in mild cognitive impairment.
21761117 2011 Intracellular clusterin negatively regulates ovarian chemoresistance: compromised expression sensitizes ovarian cancer cells to paclitaxel.
21732348 2012 mda-7/IL-24 differentially regulates soluble and nuclear clusterin in prostate cancer.
21633299 2012 Prognostic significance of clusterin expression in advanced-stage cervical cancer treated with curative intended radiotherapy.
21630085 2012 Regulation of chemosensitivity and migration by clusterin in non-small cell lung cancer cells.
21627779 2011 The membrane-spanning 4-domains, subfamily A (MS4A) gene cluster contains a common variant associated with Alzheimer's disease.
21573492 2011 Molecular mechanisms of the antimetastatic activity of nuclear clusterin in prostate cancer cells.
21567405 2012 Human nuclear clusterin mediates apoptosis by interacting with Bcl-XL through C-terminal coiled coil domain.
21543606 2011 Common Alzheimer's disease risk variant within the CLU gene affects white matter microstructure in young adults.
21527247 2011 Interaction of a putative BH3 domain of clusterin with anti-apoptotic Bcl-2 family proteins as revealed by NMR spectroscopy.
21525168 2011 Identification of increased amounts of eppin protein complex components in sperm cells of diabetic and obese individuals by difference gel electrophoresis.
21508640 2011 Association of apolipoprotein J polymorphism 1598delT with coronary artery disease and lipoprotein levels.
21505792 2011 Clusterin facilitates in vivo clearance of extracellular misfolded proteins.
21467285 2011 Plasma clusterin and the risk of Alzheimer disease.
21467232 2011 Novel changes in glycosylation of serum Apo-J in patients with hepatocellular carcinoma.
21460853 2011 ATM-dependent IGF-1 induction regulates secretory clusterin expression after DNA damage and in genetic instability.
21460841 2011 Common variants at MS4A4/MS4A6E, CD2AP, CD33 and EPHA1 are associated with late-onset Alzheimer's disease.
21447104 2011 Genetic association between clusterin polymorphisms and Alzheimer's disease in a Japanese population.
21422520 2011 Association of the Alzheimer's disease clusterin risk allele with plasma clusterin concentration.
21397462 2011 Neural hyperactivation in carriers of the Alzheimer's risk variant on the clusterin gene.
21379329 2011 Genome-wide association of familial late-onset Alzheimer's disease replicates BIN1 and CLU and nominates CUGBP2 in interaction with APOE.
21347408 2011 Fine mapping of genetic variants in BIN1, CLU, CR1 and PICALM for association with cerebrospinal fluid biomarkers for Alzheimer's disease.
21300948 2011 The role of clusterin, complement receptor 1, and phosphatidylinositol binding clathrin assembly protein in Alzheimer disease risk and cerebrospinal fluid biomarker levels.
21280673 2011 Serum clusterin levels are not increased in presymptomatic Alzheimer's disease.
21242307 2011 Clusterin (apolipoprotein J), a molecular chaperone that facilitates degradation of the copper-ATPases ATP7A and ATP7B.
21240462 2011 Increase in clusterin forms part of the stress response in Hodgkin's lymphoma.
21224044 2011 Evidence for a functional role of the molecular chaperone clusterin in amyloidotic cardiomyopathy.
21135756 2011 Effect of obesity on plasma clusterin, [corrected] a proposed modulator of leptin action.
21059989 2011 Identification of novel loci for Alzheimer disease and replication of CLU, PICALM, and BIN1 in Caribbean Hispanic individuals.
21043527 2011 Proteomic signature of Apolipoprotein J in the early phase of new-onset myocardial infarction.
21042904 2011 CLU blocks HDACI-mediated killing of neuroblastoma.
20930273 2011 Linkage to the 8p21.1 region Including the CLU gene in age at onset stratified alzheimer's disease families.
20873220 [Analysis of clusterin gene (CLU/APOJ) polymorphism in Alzheimer's disease patients and in normal cohorts from Russian populations].
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20850846 2011 Association of the clusterin gene polymorphisms with type 2 diabetes mellitus.
20847305 2010 Low clusterin levels in high-density lipoprotein associate with insulin resistance, obesity, and dyslipoproteinemia.
20842452 2011 Golgi phosphoprotein 2 (GOLPH2/GP73/GOLM1) interacts with secretory clusterin.
20739100 2011 Genetic variations in the CLU and PICALM genes are associated with cognitive function in the oldest old.
20738160 2010 Association analysis between the rs11136000 single nucleotide polymorphism in clusterin gene, rs3851179 single nucleotide polymorphism in clathrin assembly lymphoid myeloid protein gene and the patients with schizophrenia in the Chinese population.
20697030 2010 Meta-analysis confirms CR1, CLU, and PICALM as alzheimer disease risk loci and reveals interactions with APOE genotypes.
20674675 2010 APP, APOE, complement receptor 1, clusterin and PICALM and their involvement in the herpes simplex life cycle.
20614220 2010 Clusterin immunoexpression and its clinical significance in patients with non-small cell lung cancer.
20603455 2010 Association of plasma clusterin concentration with severity, pathology, and progression in Alzheimer disease.
20599866 2010 Implication of CLU gene polymorphisms in Chinese patients with Alzheimer's disease.
20570404 2012 Association of CLU and PICALM variants with Alzheimer's disease.
20554627 2010 Replication of CLU, CR1, and PICALM associations with alzheimer disease.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20534741 2010 Association of CR1, CLU and PICALM with Alzheimer's disease in a cohort of clinically characterized and neuropathologically verified individuals.
20497247 2010 Clusterin expression is associated with decreased disease-free survival of patients with colorectal carcinomas.
20460622 2010 Genome-wide analysis of genetic loci associated with Alzheimer disease.
20410100 2010 Genetic variation in APOJ, LPL, and TNFRSF10B affects plasma fatty acid distribution in Alaskan Eskimos.
20353268 2010 Overexpression of clusterin correlates with tumor progression, metastasis in gastric cancer: a study on tissue microarrays.
20209083 2010 Genetic variability in CLU and its association with Alzheimer's disease.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20096688 2010 Chibby interacts with NBPF1 and clusterin, two candidate tumor suppressors linked to neuroblastoma.
20068069 2010 Clusterin facilitates COMMD1 and I-kappaB degradation to enhance NF-kappaB activity in prostate cancer cells.
20058210 2010 Clusterin expression inversely correlates with chemosensitivity and predicts poor survival in patients with locally advanced cervical cancer treated with cisplatin-based neoadjuvant chemotherapy and radical hysterectomy.
20057494 2010 Alzheimer disease: New light on an old CLU.
20028970 2010 Identification of clusterin domain involved in NF-kappaB pathway regulation.
20019877 2009 Protective effect of clusterin on oxidative stress-induced cell death of human corneal endothelial cells.
20009887 2009 Overexpression of clusterin in ovarian cancer is correlated with impaired survival.
20007348 2010 Loss of clusterin expression worsens renal ischemia-reperfusion injury.
19996109 2010 Identification of human plasma proteins as major clients for the extracellular chaperone clusterin.
19940549 2009 Regulation of clusterin expression in human cancer via DNA methylation.
19935703 2010 Transcriptome profiling of a TGF-beta-induced epithelial-to-mesenchymal transition reveals extracellular clusterin as a target for therapeutic antibodies.
19903745 2010 The clusterin paradigm in prostate and breast carcinogenesis.
19903339 2009 Gene expression profiling in sinonasal adenocarcinoma.
19879423 2009 Clusterin (CLU) and lung cancer.
19879422 2009 CLU and colon cancer. The dual face of CLU: from normal to malignant phenotype.
19879421 2009 The role of clusterin (CLU) in malignant transformation and drug resistance in breast carcinomas.
19879420 2009 Clusterin (CLU) and prostate cancer.
19878774 2009 Chapter 6: The chaperone action of Clusterin and its putative role in quality control of extracellular protein folding.
19878770 2009 Chapter 2: Clusterin (CLU): From one gene and two transcripts to many proteins.
19878569 2009 Candidate genetic analysis of plasma high-density lipoprotein-cholesterol and severity of coronary atherosclerosis.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
19814590 2010 Localization of the potential zonal marker clusterin in native cartilage and in tissue-engineered constructs.
19793084 2009 Clusterin as a predictor for chemoradiotherapy sensitivity and patient survival in esophageal squamous cell carcinoma.
19757199 2010 Clusterin as a diagnostic and prognostic marker for transitional cell carcinoma of the bladder.
19734903 2009 Genome-wide association study identifies variants at CLU and CR1 associated with Alzheimer's disease.
19734902 2009 Genome-wide association study identifies variants at CLU and PICALM associated with Alzheimer's disease.
19664600 2009 Clusterin regulates transthyretin amyloidosis.
19651157 2009 Clusterin: a forgotten player in Alzheimer's disease.
19542874 2009 Clusterin is expressed in normal synoviocytes and in tenosynovial giant cell tumors of localized and diffuse types: diagnostic and histogenetic implications.
19535339 2009 Structural characterization of clusterin-chaperone client protein complexes.
19446882 2009 A novel mutation in the complement regulator clusterin in recurrent hemolytic uremic syndrome.
19413638 2009 Clusterin expression in cholestasis, hepatocellular carcinoma and liver fibrosis.
19391138 2009 Roles of clusterin in progression, chemoresistance and metastasis of human ovarian cancer.
19357365 2009 Clusterin facilitates exchange of glycosyl phosphatidylinositol-linked SPAM1 between reproductive luminal fluids and mouse and human sperm membranes.
19353783 2009 Transcriptional and posttranslational regulation of clusterin by the two main cellular proteolytic pathways.
19344414 2009 Risk of non-Hodgkin lymphoma in association with germline variation in complement genes.
19289586 2009 Clusterin expression correlates with stage and presence of large cells in mycosis fungoides.
19264665 2009 Hepatitis delta virus epigenetically enhances clusterin expression via histone acetylation in human hepatocellular carcinoma cells.
19220628 2009 Clusterin expression in cutaneous CD30-positive lymphoproliferative disorders and their histologic simulants.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19182256 2009 Exploring functional candidate genes for genetic association in german patients with pseudoexfoliation syndrome and pseudoexfoliation glaucoma.
19177010 2009 Interleukin-6 affects cell death escaping mechanisms acting on Bax-Ku70-Clusterin interactions in human colon cancer progression.
19166932 2009 Clusterin silencing in human lung adenocarcinoma cells induces a mesenchymal-to-epithelial transition through modulating the ERK/Slug pathway.
19165232 2009 Genome-wide association study of panic disorder in the Japanese population.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19137541 2009 Clusterin is a short half-life, poly-ubiquitinated protein, which controls the fate of prostate cancer cells.
19118032 2009 Intracellular clusterin inhibits mitochondrial apoptosis by suppressing p53-activating stress signals and stabilizing the cytosolic Ku70-Bax protein complex.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18842294 2008 Association between the SERPING1 gene and age-related macular degeneration: a two-stage case-control study.
18813793 2008 Clusterin: a potential target for improving response to antiestrogens.
18806885 2008 Genetic analysis of the clusterin gene in pseudoexfoliation syndrome.
18786636 2008 Human cellular prion protein interacts directly with clusterin protein.
18780401 2008 Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.
18714397 2008 Clusterin interacts with Paclitaxel and confer Paclitaxel resistance in ovarian cancer.
18712185 Apolipoprotein J and leptin levels in patients with coronary heart disease.
18709641 2008 Four potential biomarkers as prognostic factors in stage III serous ovarian adenocarcinomas.
18649357 2008 Clusterin is epigenetically regulated in prostate cancer.
18612545 2008 Potential protective role of apoprotein J (clusterin) in atherogenesis: binding to enzymatically modified low-density lipoprotein reduces fatty acid-mediated cytotoxicity.
18542050 2008 TRPM2-mediated Ca2+influx induces chemokine production in monocytes that aggravates inflammatory neutrophil infiltration.
18514801 2008 Differential expression of clusterin according to histological type of endometrial carcinoma.
18458059 2008 Cancer cell-derived clusterin modulates the phosphatidylinositol 3'-kinase-Akt pathway through attenuation of insulin-like growth factor 1 during serum deprivation.
18378577 2008 Increased clusterin expression in Fuchs' endothelial dystrophy.
18239862 2008 Clusterin expression in non-neoplastic adenohypophyses and pituitary adenomas: cytoplasmic clusterin localization in adenohypophysis is related to aging.
18097679 2008 Clusterin in human gut-associated lymphoid tissue, tonsils, and adenoids: localization to M cells and follicular dendritic cells.
18082619 2008 Clusterin, a novel modulator of TGF-beta signaling, is involved in Smad2/3 stability.
18079682 2007 Ocular clusterin expression in von Hippel-Lindau disease.
17974975 2007 Clusterin isoforms differentially affect growth and motility of prostate cells: possible implications in prostate tumorigenesis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17872975 2007 Clusterin associates with altered elastic fibers in human photoaged skin and prevents elastin from ultraviolet-induced aggregation in vitro.
17855704 2007 Cytoplasmic clusterin expression is associated with longer survival in patients with resected non small cell lung cancer.
17689225 2007 Multiple pathways regulating the anti-apoptotic protein clusterin in breast cancer.
17567961 2007 Characterization of an eppin protein complex from human semen and spermatozoa.
17535098 Anaplastic large cell lymphomas: a study of 75 pediatric patients.
17534116 2007 Modulation of Ku70/80, clusterin/ApoJ isoforms and Bax expression in indocyanine-green-mediated photo-oxidative cell damage.
17512083 2007 Functional association of the morphogenic factors with the clusterin for the pancreatic beta-cell differentiation.
17451556 2007 Stress-induced retrotranslocation of clusterin/ApoJ into the cytosol.
17420006 2007 Epigenetic regulation of clusterin/apolipoprotein J expression in retinal pigment epithelial cells.
17412999 2007 The extracellular chaperone clusterin influences amyloid formation and toxicity by interacting with prefibrillar structures.
17407782 2007 The extracellular chaperone clusterin potently inhibits human lysozyme amyloid formation by interacting with prefibrillar species.
17322305 2007 Clusterin expression in normal mucosa and colorectal cancer.
17260971 2007 Effects of glycosylation on the structure and function of the extracellular chaperone clusterin.
17224269 2007 Clusterin over-expression modulates proapoptotic and antiproliferative effects of 1,25(OH)2D3 in prostate cancer cells in vitro.
17203891 2007 Prognostic significance of clusterin immunoreactivity in breast cancer.
17170699 2007 ERp57 is essential for efficient folding of glycoproteins sharing common structural domains.
17148459 2007 Differential regulation of clusterin and its isoforms by androgens in prostate cells.
17080454 2007 Low-power millimeter wave radiations do not alter stress-sensitive gene expression of chaperone proteins.
17056579 2006 Characterization and functional consequences of underexpression of clusterin in rheumatoid arthritis.
17048076 2006 Clusterin and DNA repair: a new function in cancer for a key player in apoptosis and cell cycle control.
17043677 2007 Disrupted in Schizophrenia 1 Interactome: evidence for the close connectivity of risk genes and a potential synaptic basis for schizophrenia.
16955214 Clusterin/Apolipoprotein J up-regulation after zinc exposure, replicative senescence or differentiation of human haematopoietic cells.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16775601 2006 Glomerular clusterin is associated with PKC-alpha/beta regulation and good outcome of membranous glomerulonephritis in humans.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
16709934 2006 Clusterin decreases oxidative stress in lung fibroblasts exposed to cigarette smoke.
16709604 2006 Decrease of both stem cell factor and clusterin mRNA levels in testicular biopsies of azoospermic patients with constitutive or idiopathic but not acquired spermatogenic failure.
16682745 2006 Isolation and characterization of human apolipoprotein M-containing lipoproteins.
16675913 2006 Expression of the antiapoptotic proteins clusterin and bcl-2 in laryngeal squamous cell carcinomas.
16548883 2006 Transcriptomic and proteomic analyses of rhabdomyosarcoma cells reveal differential cellular gene expression in response to enterovirus 71 infection.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16490286 2006 Clusterin in cerebrospinal fluid: analysis of carbohydrates and quantification of native and glycosylated forms.
16464517 2006 Clusterin up-regulation following sub-lethal oxidative stress and lipid peroxidation in human neuroblastoma cells.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16331665 2006 Nuclear clusterin accumulation during heat shock response: implications for cell survival and thermo-tolerance induction in immortalized and prostate cancer cells.
16263699 2006 Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach.
16179938 2006 Challenge and promise: roles for clusterin in pathogenesis, progression and therapy of cancer.
16113678 2005 Clusterin inhibits apoptosis by interacting with activated Bax.
15955107 2005 Clusterin regulates drug-resistance in melanoma cells.
15929184 2005 Oncogenic role of clusterin overexpression in multistage colorectal tumorigenesis and progression.
15925890 2005 Association of apolipoprotein J gene 866C-->T polymorphism with preeclampsia and essential hypertension.
15897157 2005 Association of apolipoprotein J-positive beta-amyloid plaques with dystrophic neurites in Alzheimer's disease brain.
15883054 2005 Insertion/deletion polymorphism in clusterin gene influences serum lipid levels and carotid intima-media thickness in hypertensive Japanese females.
15857407 2005 Apolipoprotein J (clusterin) activates rodent microglia in vivo and in vitro.
15809754 2005 Enhanced radiosensitivity by inhibition of the anti-apoptotic gene clusterin using antisense oligodeoxynucleotide in a human bladder cancer model.
15791650 2005 Dys-regulation of clusterin in human hepatoma is not associated with tumorigenesis but is secondary to cell response to external tresses.
15689620 2005 Delayed activation of insulin-like growth factor-1 receptor/Src/MAPK/Egr-1 signaling regulates clusterin expression, a pro-survival factor.
15649646 2005 Differential effects of clusterin/apolipoprotein J on cellular growth and survival.
15591223 2005 Modulation of clusterin isoforms is associated with all-trans retinoic acid-induced proliferative arrest and apoptosis of intimal smooth muscle cells.
15538973 2004 Ectopic expression of clusterin/apolipoprotein J or Bcl-2 decreases the sensitivity of HaCaT cells to toxic effects of ropivacaine.
15499376 2005 Ca2+ depletion induces nuclear clusterin, a novel effector of apoptosis in immortalized human prostate cells.
15492264 2004 Clusterin-mediated apoptosis is regulated by adenomatous polyposis coli and is p21 dependent but p53 independent.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15480429 2004 Isolation and characterization of a novel gene CLUAP1 whose expression is frequently upregulated in colon cancer.
15389725 2004 Protection of androgen-dependent human prostate cancer cells from oxidative stress-induced DNA damage by overexpression of clusterin and its modulation by androgen.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15304052 2004 Transcriptional down-regulation of the platelet ADP receptor P2Y(12) and clusterin in patients with systemic lupus erythematosus.
15252304 2004 Clusterin expression distinguishes follicular dendritic cell tumors from other dendritic cell neoplasms: report of a novel follicular dendritic cell marker and clinicopathologic data on 12 additional follicular dendritic cell tumors and 6 additional interdigitating dendritic cell tumors.
15247015 2004 Functional analysis of clusterin/apolipoprotein J in cellular death induced by severe genotoxic stress.
15158456 2004 Involvement of clusterin in 15-deoxy-delta12,14-prostaglandin J2-induced vascular smooth muscle cell differentiation.
15146195 2004 Time-controlled transcardiac perfusion cross-linking for the study of protein interactions in complex tissues.
15133840 2004 Alterations in expression, proteolysis and intracellular localizations of clusterin in esophageal squamous cell carcinoma.
15033782 2003 Nuclear translocation of a clusterin isoform is associated with induction of anoikis in SV40-immortalized human prostate epithelial cells.
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14630798 2004 Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.
14618611 2004 Clusterin (SGP-2, ApoJ) expression is downregulated in low- and high-grade human prostate cancer.
12882985 2003 Essential requirement of apolipoprotein J (clusterin) signaling for IkappaB expression and regulation of NF-kappaB activity.
12867999 2003 Alterations in the post-translational modification and intracellular trafficking of clusterin in MCF-7 cells during apoptosis.
12860995 2003 Clusterin, an abundant serum factor, is a possible negative regulator of MT6-MMP/MMP-25 produced by neutrophils.
12824284 2003 A model for modulation of leptin activity by association with clusterin.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12679903 2003 Loss of clusterin both in serum and tissue correlates with the tumorigenesis of esophageal squamous cell carcinoma via proteomics approaches.
12551933 2003 Synthesis and functional analyses of nuclear clusterin, a cell death protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12470829 Serum levels of the senescence biomarker clusterin/apolipoprotein J increase significantly in diabetes type II and during development of coronary heart disease or at myocardial infarction.
12429802 2002 Clusterin expression in malignant lymphomas: a survey of 266 cases.
12427144 2002 Depletion of clusterin in renal diseases causing nephrotic syndrome.
12393179 2002 Isolation of differentially expressed genes in human heart tissues.
12200037 2002 Clusterin/apolipoprotein J in human aging and cancer.
12176985 2002 Mildly acidic pH activates the extracellular molecular chaperone clusterin.
12172907 2002 Clusterin/apolipoprotein J is associated with cortical Lewy bodies: immunohistochemical study in cases with alpha-synucleinopathies.
12047389 2002 Suppression of apolipoprotein C-II amyloid formation by the extracellular chaperone, clusterin.
11906815 2002 Clusterin.
11904161 2002 Clusterin is an extracellular chaperone that specifically interacts with slowly aggregating proteins on their off-folding pathway.
11892985 2002 Overexpression of apolipoprotein J in human fibroblasts protects against cytotoxicity and premature senescence induced by ethanol and tert-butylhydroperoxide.
11795992 2001 Clusterin expression in adult human normal and osteoarthritic articular cartilage.
11570883 2001 Clusterin, a binding protein with a molten globule-like region.
11186422 2000 Localisation of clusterin in normal human sperm by immunogold electron microscopy.
11123922 2000 Clusterin is an ATP-independent chaperone with very broad substrate specificity that stabilizes stressed proteins in a folding-competent state.
10694874 2000 Clusterin is a secreted mammalian chaperone.
10329371 1999 Binding of gelsolin, a secretory protein, to amyloid beta-protein.
10219089 1999 Isolation of Ku70-binding proteins (KUBs).
10066740 1999 Clusterin has chaperone-like activity similar to that of small heat shock proteins.
9560017 1998 Possible neuroprotective role of clusterin in Alzheimer's disease: a quantitative immunocytochemical study.
9537999 1998 Characterization of the heparin-binding properties of human clusterin.
9336835 1997 Identification and characterization of glycosylation sites in human serum clusterin.
9228033 1997 Interaction of apolipoprotein J-amyloid beta-peptide complex with low density lipoprotein receptor-related protein-2/megalin. A mechanism to prevent pathological accumulation of amyloid beta-peptide.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8843912 1996 Apolipoprotein J expression in human ocular surface epithelium.
8759347 1996 A gene expression profile of human corneal epithelium and the isolation of human keratin 12 cDNA.
8752142 1996 Clusterin (Apo J) protects against in vitro amyloid-beta (1-40) neurotoxicity.
8634259 1996 Transforming growth factor beta (TGF beta)-induced nuclear localization of apolipoprotein J/clusterin in epithelial cells.
8555189 1996 Interaction of transforming growth factor beta receptors with apolipoprotein J/clusterin.
8387101 1993 Elevation of human cerebrospinal fluid clusterin concentration is associated with acute neuropathology.
8345200 1993 Clusterin, the human apolipoprotein and complement inhibitor, binds to complement C7, C8 beta, and the b domain of C9.
8328966 1993 The cerebrospinal-fluid soluble form of Alzheimer's amyloid beta is complexed to SP-40,40 (apolipoprotein J), an inhibitor of the complement membrane-attack complex.
8314591 1993 Human clusterin (CLI) maps to 8p21 in proximity to the lipoprotein lipase (LPL) gene.
8292612 1994 Apolipoprotein J is associated with paraoxonase in human plasma.
8181474 1994 Molecular characterization of human TRPM-2/clusterin, a gene associated with sperm maturation, apoptosis and neurodegeneration.
7768901 1995 Identification of glycoprotein 330 as an endocytic receptor for apolipoprotein J/clusterin.
7626703 1995 Expression of apolipoprotein J in the uterus is associated with tissue remodeling.
7615015 1995 Local synthesis of apolipoprotein J in the eye.
3167096 1988 Isolation and characterization of sulfated glycoprotein from human pancreatic juice.
3154963 1988 HDL particle associated proteins in plasma and cerebrospinal fluid: identification and partial sequencing.
2780570 1989 Changes in brain gene expression shared by scrapie and Alzheimer disease.
2780565 1989 Molecular structure and functional characterization of a human complement cytolysis inhibitor found in blood and seminal plasma: identity to sulfated glycoprotein 2, a constituent of rat testis fluid.
2721499 1989 Molecular cloning and characterization of the novel, human complement-associated protein, SP-40,40: a link between the complement and reproductive systems.
2601725 1989 A serum protein SP40,40 modulates the formation of membrane attack complex of complement on erythrocytes.
2454950 1988 SP-40,40, a newly identified normal human serum protein found in the SC5b-9 complex of complement and in the immune deposits in glomerulonephritis.
2387851 1990 Purification and characterization of apolipoprotein J.
2185274 1990 Human seminal clusterin (SP-40,40). Isolation and characterization.
1974459 1990 Apolipoprotein J: structure and tissue distribution.
1924317 1991 Human gliomas and epileptic foci express high levels of a mRNA related to rat testicular sulfated glycoprotein 2, a purported marker of cell death.
1903064 Characterization of a human high density lipoprotein-associated protein, NA1/NA2. Identity with SP-40,40, an inhibitor of complement-mediated cytolysis.
1742316 1991 The apolipoprotein A-I binding protein of placenta and the SP-40,40 protein of human blood are different proteins which both bind to apolipoprotein A-I.
1585460 1992 Clusterin: the intriguing guises of a widely expressed glycoprotein.
1551440 1992 SP-40,40, a protein involved in the control of the complement pathway, possesses a unique array of disulphide bridges.
1491011 1992 Identification of the disulfide bonds in human plasma protein SP-40,40 (apolipoprotein-J).
1424805 1992 Regional localization of the gene for clusterin (SP-40,40; gene symbol CLI) to human chromosome 8p12-->p21.