Property Summary

NCBI Gene PubMed Count 209
Grant Count 87
R01 Count 32
Funding $9,769,877.85
PubMed Score 609.94
PubTator Score 407.03

Knowledge Summary

Patent (75,168)

TINX Plot

  Disease Relevance (54)

Disease Z-score Confidence
Hypothyroidism 89 6.164 3.1
Hyperthyroidism 50 5.589 2.8
Goiter 27 5.283 2.6
Thyrotoxicosis 38 5.159 2.6
Hyperthyroxinemia 9 4.411 2.2
Attention deficit hyperactivity disorder 156 3.693 1.8
Graves' disease 25 3.394 1.7
Cancer 2,346 3.341 1.7
Radial neuropathy 3 3.253 1.6
Becker muscular dystrophy 187
Breast cancer 3,094
Congenital hypothyroidism 20
Craniofacial Abnormalities 147
Diagnostic Test for Thyroid Dysfunction 3
Diaphragmatic Hernia 40
Finding of Mean Corpuscular Hemoglobin 14
Hashimoto thyroiditis 2
Hyperlipidemia 25
Malignant tumor of thyroid gland 3
Mild Hypothyroidism 2
Myxedema 8
Myxedema coma 2
Peripheral vascular disease 90 2.0
Simple goiter 2
T3 Suppression for Thyroid Function Test 2
THYROID HORMONE RESISTANCE, GENERALIZED,... 1 
THYROID HORMONE RESISTANCE, SELECTIVE PI... 1 
Thyroid Hormone Resistance Syndrome 4
Thyroid Hormone Resistance, Generalized,... 1 
adrenocortical carcinoma 1,427
astrocytic glioma 2,241
atypical teratoid / rhabdoid tumor 4,369
breast carcinoma 1,614
colon cancer 1,475
cystic fibrosis 1,665
ductal carcinoma in situ 1,745
ependymoma 2,514
glioblastoma 5,572
group 4 medulloblastoma 1,875
head and neck cancer 270
hereditary spastic paraplegia 313
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
invasive ductal carcinoma 2,950
lung cancer 4,466
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
pediatric high grade glioma 2,712
primitive neuroectodermal tumor 3,031
psoriasis 6,685
ulcerative colitis 2,087

Expression

  Differential Expression (27)

Disease log2 FC p
astrocytic glioma -2.200 0.003
ependymoma -2.700 0.003
oligodendroglioma -2.000 0.000
psoriasis 1.200 0.000
glioblastoma -3.900 0.000
osteosarcoma -1.324 0.027
group 4 medulloblastoma -4.800 0.000
cystic fibrosis -3.285 0.000
atypical teratoid / rhabdoid tumor -4.600 0.000
medulloblastoma, large-cell -5.500 0.000
primitive neuroectodermal tumor -3.700 0.000
Becker muscular dystrophy -1.040 0.013
hereditary spastic paraplegia -1.034 0.022
adrenocortical carcinoma -1.811 0.003
intraductal papillary-mucinous adenoma (... 1.500 0.001
lung cancer -2.300 0.001
colon cancer -2.400 0.000
interstitial cystitis -2.600 0.000
pediatric high grade glioma -2.700 0.000
Breast cancer -1.800 0.000
invasive ductal carcinoma -2.000 0.006
lung carcinoma -1.300 0.000
breast carcinoma -1.300 0.000
ductal carcinoma in situ -1.800 0.000
ulcerative colitis -1.300 0.010
ovarian cancer 1.200 0.004
head and neck cancer -1.200 0.000

Synonym

Accession P10828 B3KU79 P37243 Q13986 Q3KP35 Q6WGL2 Q9UD41
Symbols GRTH
PRTH
THR1
ERBA2
NR1A2
THRB1
THRB2
C-ERBA-2
C-ERBA-BETA

Gene

PDB

1BSX   1N46   1NAX   1NQ0   1NQ1   1NQ2   1NUO   1Q4X   1R6G   1XZX   1Y0X   2J4A   2NLL   2PIN   3D57   3GWS   3IMY   3JZC   4ZO1  

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

MLP Assay (17)

AID Type Active / Inconclusive / Inactive Description
1469 confirmatory 183 / 1030 / 281374 qHTS for Inhibitors of the Interaction of Thyroid Hormone Receptor and Steroid Receptor Coregulator 2
1479 confirmatory 816 / 3497 / 278274 Total Fluorescence Counterscreen for Inhibitors of the Interaction of Thyroid Hormone Receptor and Steroid Receptor Coregulator 2
1485 summary 1 / 0 / 0 Quantitative High-Throughput Screen for Inhibitors of the Interaction of Thyroid Hormone Receptor and Steroid Receptor Coregulator 2: Summary
1567 confirmatory 8 / 61 / 34 Cell-based Gene Reporter Secondary Assay to Characterize qHTS Inhibitors of the Interaction of Thyroid Hormone Receptor and Steroid Receptor Coregulator 2
1568 confirmatory 6 / 19 / 78 Cell Viability Secondary Assay to Characterize qHTS Inhibitors of the Interaction of Thyroid Hormone Receptor and Steroid Receptor Coregulator 2
1570 confirmatory 17 / 59 / 36 Concentration Response Confirmation Assay for Inhibitors of the Interaction of Thyroid Hormone Receptor and Steroid Receptor Coregulator 2, Fluorescein Fluoroprobe
1571 confirmatory 8 / 21 / 83 Total Fluorescence Confirmation Counterscreen for Inhibitors of the Interaction of Thyroid Hormone Receptor and Steroid Receptor Coregulator 2, Fluorescein Fluoroprobe
1572 confirmatory 6 / 13 / 93 Total Fluorescence Confirmation Counterscreen for Inhibitors of the Interaction of Thyroid Hormone Receptor and Steroid Receptor Coregulator 2
1573 confirmatory 27 / 65 / 20 Concentration Response Confirmation Assay for Inhibitors of the Interaction of Thyroid Hormone Receptor and Steroid Receptor Coregulator 2
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
More...

Gene RIF (134)

PMID Text
26350179 Loss of heterozygosity in THRB and its proximal microsatellite markers may play a role in tumorigenesis and development in invasive breast cancer.
26273722 It is demonstrated in this article that the A234T mutation in the THR-beta gene can cause the thyroid hormone resistance syndrome.
26041374 p.H271D mutation associated with resistance thyroid hormone syndrome
26029931 The current study aimed to investigate whether TRs may be specifically expressed in BRCA1 associated cancer cases.
26003825 Down-regulation of THRbeta correlates with the reduction of all markers of differentiation and is associated with overexpression of some miRNAs supposed to play a role in thyroid tumorigenesis.
25924236 propose that the mutated C-terminal region of TRbeta1 could function as an "onco-domain"
25820519 Results showed that triple negative breast cancer patients expressed low level of THRB which was associated with poor outcome and enhanced resistance to both docetaxel and doxorubicin treatment.
25738994 diagnosis was confirmed by direct THRB sequencing that revealed 2 novel mutations: the heterozygous p.Ala317Ser in subject 1 and the heterozygous p.Arg438Pro in subject 2
25572392 data demonstrate that TR sumoylation is required for activation of the Wnt canonical signaling pathway during preadipocyte proliferation and enhances the PPARgamma signaling that promotes differentiation
25502991 cases suggested that certain RTHbeta mutants such as p.R316C might show very mild syndrome of inappropriate secretion of thyrotropin in spite of having apparent peripheral resistance to thyroid hormone
More...

AA Sequence

MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQTTWTSSIFHL      1 - 70
DHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLH     71 - 140
PSYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVLDDSKRLAKRKLIEENREKRRREELQKSIGH    141 - 210
KPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAI    211 - 280
TRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVS    281 - 350
DAIFDLGMSLSSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK    351 - 420
LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED                                 421 - 461
//

Text Mined References (215)

PMID Year Title
26350179 Loss of heterozygosity in thyroid hormone receptor beta in invasive breast cancer.
26273722 2015 A Rare Mutation in Patients With Resistance to Thyroid Hormone and Review of Therapeutic Strategies.
26041374 2015 Characteristics of patients with late manifestation of resistance thyroid hormone syndrome: a single-center experience.
26029931 2015 Thyroid Hormone Receptors Predict Prognosis in BRCA1 Associated Breast Cancer in Opposing Ways.
26003825 2015 Reduced expression of THR? in papillary thyroid carcinomas: relationship with BRAF mutation, aggressiveness and miR expression.
25924236 2015 Oncogenic mutations of thyroid hormone receptor ?.
25820519 2015 Targeting thyroid hormone receptor beta in triple-negative breast cancer.
25738994 2015 Two Novel Mutations in the Thyroid Hormone Receptor ? in Patients with Resistance to Thyroid Hormone (RTH ?): Clinical, Biochemical, and Molecular Data.
25572392 2015 Thyroid hormone receptor sumoylation is required for preadipocyte differentiation and proliferation.
25502991 2015 A family of RTH? with p.R316C mutation presenting occasional syndrome of inappropriate secretion of TSH.
More...