Property Summary

Ligand Count 107
NCBI Gene PubMed Count 136
PubMed Score 527.45
PubTator Score 229.05

Knowledge Summary

Patent (109,873)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Hyperthyroidism 53 4.348 2.2
Cancer 2499 3.715 1.9
Hyperthyroxinemia 9 3.627 1.8

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.200 1.8e-03
atypical teratoid / rhabdoid tumor -1.300 1.0e-08
breast carcinoma -1.500 1.6e-07
glioblastoma -1.200 6.1e-04
lung adenocarcinoma -1.600 4.8e-09
malignant mesothelioma -1.100 1.4e-04
medulloblastoma, large-cell -1.200 1.3e-05
osteosarcoma -2.119 1.4e-06
ovarian cancer -1.200 2.0e-08
psoriasis -2.100 1.0e-04
sonic hedgehog group medulloblastoma -1.200 8.1e-06
subependymal giant cell astrocytoma -1.276 9.0e-03

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (79)

AA Sequence

MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITC      1 - 70
EGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEQ     71 - 140
NRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNAQGSHWKQRRKFLPDDIGQSPIVSMPDGDKV    141 - 210
DLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEM    211 - 280
AVKREQLKNGGLGVVSDAIFELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFE    281 - 350
HYVNHRKHNIPHFWPKLLMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQL    351 - 420
GEAGSLQGPVLQHQSPKSPQQRLLELLHRSGILHARAVCGEDDSSEADSPSSSEEEPEVCEDLAGNAASP    421 - 490
//

Text Mined References (144)

PMID Year Title