Property Summary

NCBI Gene PubMed Count 132
Grant Count 80
R01 Count 32
Funding $11,287,527.85
PubMed Score 522.91
PubTator Score 229.05

Knowledge Summary

Patent (109,873)

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
psoriasis -2.100 0.000
osteosarcoma -2.119 0.000
glioblastoma -1.600 0.010
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -1.400 0.000
breast carcinoma -1.500 0.000
pediatric high grade glioma -1.300 0.009
sonic hedgehog group medulloblastoma -1.200 0.000
subependymal giant cell astrocytoma -1.276 0.009
lung adenocarcinoma -1.600 0.000
ovarian cancer -1.200 0.000

Synonym

Accession P10827 A8K3B5 P21205 Q8N6A1 Q96H73
Symbols AR7
EAR7
ERBA
CHNG6
ERBA1
NR1A1
THRA1
THRA2
ERB-T-1
c-ERBA-1

Gene

PDB

1NAV   2H77   2H79   3HZF   3ILZ   3JZB   4LNW   4LNX  

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (76)

PMID Text
26585273 8 different THRA gene abnormalities have been described in 14 patients from 9 families with phenotypes including short stature, dysmorphic syndrome, psychoneuromotor disorders, constipation and bradycardia. Review.
26029931 The current study aimed to investigate whether TRs may be specifically expressed in BRCA1 associated cancer cases.
25670821 THRA mutations may be more common than expected. In patients with clinical symptoms of mild hypothyreosis without confirmation in endocrine studies, a molecular study of THRA defects is strongly recommended.
25542270 Thyroid hormone signalling may be important in a proportion of breast cancers and THRalpha2 expression may be a regulator of signalling in this pathway.
25501869 Thyroid hormone receptor (TRalpha1) is shown to occur and determine postischemic remodeling and cardiac recovery depending on the availability of TH. [review]
25079464 THRalpha rs939348 polymorphism was associated with L-T4 dose and central obesity among hypothyroid patients.
24969835 Data suggest thyroid hormone resistance syndrome can be exhibited by patients with heterozygous missense mutation (Ala263Val) in THRA1 and THRA2, isoforms resulting from alternative splicing. [CASE REPORT]
24914936 Thyroid hormone receptor alpha mutation is associated with a severe and thyroxine-resistant skeletal dysplasia.
24673558 Transactivation of reporter genes in response to T4 thyroid hormone was dependent on the thyroid hormone receptor subtypes in human cells.
24552590 A new x-ray crystallographic structure of thyroid hormone receptor ligand-binding domains shows a second binding site for thyroid hormones.
More...

AA Sequence

MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITC      1 - 70
EGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEQ     71 - 140
NRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNAQGSHWKQRRKFLPDDIGQSPIVSMPDGDKV    141 - 210
DLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEM    211 - 280
AVKREQLKNGGLGVVSDAIFELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFE    281 - 350
HYVNHRKHNIPHFWPKLLMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQL    351 - 420
GEAGSLQGPVLQHQSPKSPQQRLLELLHRSGILHARAVCGEDDSSEADSPSSSEEEPEVCEDLAGNAASP    421 - 490
//

Text Mined References (140)

PMID Year Title
26585273 2015 TR? receptor mutations extend the spectrum of syndromes of reduced sensitivity to thyroid hormone.
26037512 2015 A Novel Mutation in THRA Gene Associated With an Atypical Phenotype of Resistance to Thyroid Hormone.
26029931 2015 Thyroid Hormone Receptors Predict Prognosis in BRCA1 Associated Breast Cancer in Opposing Ways.
25670821 2015 Thyroid hormone resistance syndrome due to mutations in the thyroid hormone receptor ? gene (THRA).
25542270 2015 Thyroid hormone receptor ? in breast cancer: prognostic and therapeutic implications.
25501869 2015 Translating thyroid hormone effects into clinical practice: the relevance of thyroid hormone receptor ?1 in cardiac repair.
25416956 2014 A proteome-scale map of the human interactome network.
25079464 The associations of polymorphisms of TSH receptor and thyroid hormone receptor genes with L-thyroxine treatment in hypothyroid patients.
24969835 2014 Resistance to thyroid hormone caused by a mutation in thyroid hormone receptor (TR)?1 and TR?2: clinical, biochemical, and genetic analyses of three related patients.
24914936 2014 Thyroid hormone receptor ? mutation causes a severe and thyroxine-resistant skeletal dysplasia in female mice.
More...