Property Summary

Ligand Count 100
NCBI Gene PubMed Count 211
PubMed Score 295.95
PubTator Score 519.30

Knowledge Summary

Patent (75,774)

TINX Plot

  Disease (8)

Disease Target Count P-value
Breast cancer 3578 9.6e-13
ovarian cancer 8520 1.1e-09
malignant mesothelioma 3232 2.3e-09
lung carcinoma 2843 8.2e-09
cystic fibrosis 1696 1.8e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 4.817 2.4
Microphthalmia 76 0.0 4.0
Disease Target Count
Microphthalmia syndromic 9 2

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer -1.700 9.6e-13
cystic fibrosis 1.315 1.8e-05
lung carcinoma -1.200 8.2e-09
malignant mesothelioma -5.300 2.3e-09
ovarian cancer 1.100 1.1e-09

Protein-protein Interaction (2)

Gene RIF (173)

AA Sequence

MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPATIETQSTSSEE      1 - 70
LVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRC     71 - 140
QYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTT    141 - 210
NSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPE    211 - 280
QDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDK    281 - 350
LQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGH    351 - 420
EPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ                                       421 - 455
//

Text Mined References (212)

PMID Year Title