Property Summary

NCBI Gene PubMed Count 205
Grant Count 247
R01 Count 103
Funding $33,675,599.17
PubMed Score 285.77
PubTator Score 519.30

Knowledge Summary

Patent (75,774)

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -5.300 0.000
cystic fibrosis 1.315 0.000
lung carcinoma -1.200 0.000
Breast cancer -1.700 0.000
ovarian cancer 1.100 0.000

Synonym

Accession P10826 P12891 Q00989 Q15298 Q9UN48 RAR-beta
Symbols HAP
RRB2
NR1B2
MCOPS12
RARbeta1

Gene

PDB

1HRA   1XAP   4DM6   4DM8   4JYG   4JYH   4JYI  

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (167)

PMID Text
27011326 Overexpression of miR-146a-5p and miR-146b-5p caused a 31% and 33% decrease in endogenous RARB mRNA levels.
26823825 methylated promoters of DAPK1 combined with MGMT, MGMT combined with RARB, DAPK1 combined with RARB were positive correlated with cervical disease grade
26681652 shows that RAR-beta methylation detected in lung tissue may be used as a predictive marker for non-small cell lung cancer diagnosis and that APC methylation in tumor sample may be a useful marker
26451736 RARbeta2 methylation is significantly increased in breast cancer samples when compared to non-cancerous controls
26352270 Whole-exome sequencing in a South American cohort links ALDH1A3, FOXN1 and RARB/retinoic acid regulation pathways to autism spectrum disorders.
26080448 revealed that HSP70 could directly regulate retinoid acid (RA)-induced retinoid acid receptor beta2 (RARbeta2) gene transcription through its binding to chromatin, with R469me1 being essential in this process
25981383 Curcumin upregulates RARbeta by inhibiting DNMT3b expression which reverses RARbeta promoter methylation.
25970467 Retinoic acid receptor beta and angiopoietin-like protein 1 are involved in the regulation of human androgen biosynthesis
25805039 Hypermethylation at promoters of RARB, Dietary folate and cobalamin intake is inversely associated with methylated RARB and BRCA1. High dietary intake of riboflavin and pyridoxine is associated with increased methylation in the RARB promoter.
25684670 Methylated APC and RARbeta2 genes might be valuable serum-based molecular markers for early detection of breast cancer.
More...

AA Sequence

MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPATIETQSTSSEE      1 - 70
LVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRC     71 - 140
QYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTT    141 - 210
NSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPE    211 - 280
QDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDK    281 - 350
LQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGH    351 - 420
EPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ                                       421 - 455
//

Text Mined References (206)

PMID Year Title
27011326 2016 Family of microRNA-146 Regulates RAR? in Papillary Thyroid Carcinoma.
26823825 2015 DAPK1, MGMT and RARB promoter methylation as biomarkers for high-grade cervical lesions.
26681652 2016 Promoter methylation of APC and RAR-? genes as prognostic markers in non-small cell lung cancer (NSCLC).
26451736 2015 Promoter Methylation of the Retinoic Acid Receptor Beta2 (RAR?2) Is Associated with Increased Risk of Breast Cancer: A PRISMA Compliant Meta-Analysis.
26352270 2015 Whole-Exome Sequencing in a South American Cohort Links ALDH1A3, FOXN1 and Retinoic Acid Regulation Pathways to Autism Spectrum Disorders.
26080448 2015 Arginine methylation of HSP70 regulates retinoid acid-mediated RAR?2 gene activation.
25981383 2015 Curcumin Reactivates Silenced Tumor Suppressor Gene RAR? by Reducing DNA Methylation.
25970467 2015 Retinoic acid receptor beta and angiopoietin-like protein 1 are involved in the regulation of human androgen biosynthesis.
25805039 2015 Association of folate and other one-carbon related nutrients with hypermethylation status and expression of RARB, BRCA1, and RASSF1A genes in breast cancer patients.
25684670 2015 Aberrant methylation of APC and RAR?2 genes in breast cancer patients.
More...