Property Summary

NCBI Gene PubMed Count 292
PubMed Score 3802.64
PubTator Score 2042.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
tuberculosis and treatment for 3 months 179 5.6e-03
oligodendroglioma 2850 1.2e-02
ependymoma 4679 2.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
hereditary spastic paraplegia 318 0.0 4.0

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma -1.200 2.4e-02
oligodendroglioma -1.200 1.2e-02
tuberculosis and treatment for 3 months -1.700 5.6e-03

Gene RIF (197)

AA Sequence

MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGS      1 - 70
PKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEI     71 - 140
RRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDE    141 - 210
LEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDG    211 - 280
EALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIV    281 - 350
TKDDAMLLKGKGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDR    351 - 420
VTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLI    421 - 490
VEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEVVVTEIPKEEKDPGMGA    491 - 560
MGGMGGGMGGGMF                                                             561 - 573
//

Text Mined References (310)

PMID Year Title