Property Summary

NCBI Gene PubMed Count 267
Grant Count 457
R01 Count 259
Funding $71,525,810.18
PubMed Score 3756.05
PubTator Score 2042.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma -1.200 0.024
oligodendroglioma -1.200 0.012
tuberculosis and treatment for 3 months -1.700 0.006

Synonym

Accession P10809 B2R5M6 B7Z712 Q38L19 Q9UCR6
Symbols HLD4
CPN60
GROEL
HSP60
HSP65
SPG13
HSP-60
HuCHA60

Gene

PDB

4PJ1  

Gene RIF (183)

PMID Text
26585937 Data indicate that on addition of the heat-shock proteins GroEL-GroES molecular chaperone system, the folding of the nascent chemokine receptor type 5 (CCR5) was significantly enhanced.
26477505 Heat shock protein 60 stimulates the migration of vascular smooth muscle cells via Toll-like receptor 4 and ERK MAPK activation
26442925 The data show that immunohistochemistry for CD1a and Hsp60 can be of help in differential diagnosis between Keratoacantomas and well-differentiated forms of squamous cell carcinomas.
26431161 Studies show that contrary to its role as a target for pathogenic autoimmune inflammatory processes, heat-shock protein 60 (HSP60) has been shown to activate immunoregulatory pathways that may lead to suppression of these diseases.
26335776 Biochemical and genetic data demonstrate that FUS interacts with a mitochondrial chaperonin, HSP60, and that FUS translocation to mitochondria is, at least in part, mediated by HSP60
26275591 Anti-citrullinated protein antibodies promote apoptosis of mature human osteoblasts via cell-surface binding to citrullinated heat shock protein 60.
26078803 exposure of human promyelocytic HL-60 cells to a nontoxic concentration (10 muM) of 4-hydroxy-2-nonenal (HNE) yielded a HSP60 modified with HNE.
26060090 Hsp60 was found to be increased in cancerous tissue in patients with large bowel cancer
25957474 an HLD4-associated (Asp-29-to-Gly) mutant of mitochondrial heat shock 60-kDa protein 1 (HSPD1) causes short-length morphologies and increases the numbers of mitochondria due to their aberrant fission and fusion cycles
25918392 structural analysis of mutated human Hsp60-human Hsp10 complex
More...

AA Sequence

MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGS      1 - 70
PKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEI     71 - 140
RRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDE    141 - 210
LEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDG    211 - 280
EALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIV    281 - 350
TKDDAMLLKGKGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDR    351 - 420
VTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLI    421 - 490
VEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEVVVTEIPKEEKDPGMGA    491 - 560
MGGMGGGMGGGMF                                                             561 - 573
//

Text Mined References (283)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26585937 2015 Folding of newly translated membrane protein CCR5 is assisted by the chaperonin GroEL-GroES.
26477505 2015 Heat shock protein 60 stimulates the migration of vascular smooth muscle cells via Toll-like receptor 4 and ERK MAPK activation.
26442925 2016 CD1A-positive cells and HSP60 (HSPD1) levels in keratoacanthoma and squamous cell carcinoma.
26431161 2015 HSP60: a double edge sword in autoimmunity.
26335776 2015 FUS Interacts with HSP60 to Promote Mitochondrial Damage.
26275591 2016 Anti-citrullinated protein antibodies promote apoptosis of mature human Saos-2 osteoblasts via cell-surface binding to citrullinated heat shock protein 60.
26078803 2015 Generation of Adducts of 4-Hydroxy-2-nonenal with Heat Shock 60?kDa Protein 1 in Human Promyelocytic HL-60 and Monocytic THP-1 Cell Lines.
26060090 2015 Heat shock protein 60 levels in tissue and circulating exosomes in human large bowel cancer before and after ablative surgery.
25957474 2015 Hypomyelinating leukodystrophy-associated missense mutation in HSPD1 blunts mitochondrial dynamics.
More...