Property Summary

NCBI Gene PubMed Count 21
Grant Count 21
R01 Count 17
Funding $1,357,612.6
PubMed Score 39.33
PubTator Score 36.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (2)

PMID Text
20458746 These data demonstrate that FGF-6 may be considered a regulator of bone metabolism as shown by its activity on both osteoblasts and osteoclasts.
11801566 FGF6 exhibits antitumor activity in vitro and correlates with expression of FGF receptors in medulloblastoma cells

AA Sequence

MALGQKLFITMSRGAGRLQGTLWALVFLGILVGMVVPSPAGTRANNTLLDSRGWGTLLSRSRAGLAGEIA      1 - 70
GVNWESGYLVGIKRQRRLYCNVGIGFHLQVLPDGRISGTHEENPYSLLEISTVERGVVSLFGVRSALFVA     71 - 140
MNSKGRLYATPSFQEECKFRETLLPNNYNAYESDLYQGTYIALSKYGRVKRGSKVSPIMTVTHFLPRI      141 - 208
//

Text Mined References (22)

PMID Year Title
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
23263487 2013 Genome-wide association analyses in East Asians identify new susceptibility loci for colorectal cancer.
20558539 2010 Common genetic variants associate with serum phosphorus concentration.
20458746 2010 Regulation of osteoblast and osteoclast functions by FGF-6.
20094046 2010 Fibroblast growth factor signalling: from development to cancer.
17133345 2007 Differential signal transduction of alternatively spliced FGFR2 variants expressed in human mammary epithelial cells.
16597617 2006 Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15199049 2004 Functional phylogeny relates LET-756 to fibroblast growth factor 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...