Property Summary

NCBI Gene PubMed Count 21
PubMed Score 40.20
PubTator Score 36.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
AMYOTROPHIC LATERAL SCLEROSIS 1 49 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0

Gene RIF (2)

AA Sequence

MALGQKLFITMSRGAGRLQGTLWALVFLGILVGMVVPSPAGTRANNTLLDSRGWGTLLSRSRAGLAGEIA      1 - 70
GVNWESGYLVGIKRQRRLYCNVGIGFHLQVLPDGRISGTHEENPYSLLEISTVERGVVSLFGVRSALFVA     71 - 140
MNSKGRLYATPSFQEECKFRETLLPNNYNAYESDLYQGTYIALSKYGRVKRGSKVSPIMTVTHFLPRI      141 - 208
//

Text Mined References (22)

PMID Year Title