Property Summary

NCBI Gene PubMed Count 281
PubMed Score 107.13
PubTator Score 1843.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus 2.800 0.001
osteosarcoma -1.966 0.001
lung cancer -1.100 0.006
interstitial cystitis 1.800 0.004
primary Sjogren syndrome 1.500 0.027
sarcoidosis -1.600 0.000
ovarian cancer -2.300 0.000
psoriasis 1.700 0.000

Synonym

Gene

PANTHER Protein Class (2)

PDB

5AUL   3WA4   1YJD  

  Ortholog (13)

Gene RIF (282)

PMID Text
26950734 expansion of highly differentiated CD28null T cells is associated with a lower risk for early acute rejection after kidney transplantation
26885860 in complex with T cell receptor, promotes glycolysis
26408701 Results showed lower and higher serum levels of CTLA4 and CD28 detected respectively in patients with colorectal cancer (CRC)and found an association of the CTLA4 -318C/T polymorphism in CRC patients.
26405154 A highly recurrent novel missense mutation in CD28 among angioimmunoblastic T-cell lymphoma patients.
26403483 These findings indicate that the associations of the CTLA-4 and CD28 polymorphisms with the risk of renal cancer are worth further study in a larger group of patients.
26375412 In patients presenting with acute coronary syndrome, the CD4 + CD28null T cell percentage was higher in patients with non-ST-segment-elevation acute coronary syndrome versus those with STEMI.
26277688 Among CD8+ T-lymphocytes, CD28+CD57+ cells represent a subset with some senescent features that are distinct from the CD28-CD57+ cells.
26215444 The functional decline of invariant natural killer T cells was closely related to the decrease in CD28 expression and the increases of Tim-3 and PD-1.
26043137 study also uncovered a previously unappreciated role for Vav1 in crosstalk between the CD28 and TCR signaling pathways
26041540 CD58/CD2 is the primary costimulatory pathway in human CD28-CD8+ T cells.
More...

AA Sequence

MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYG      1 - 70
NYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHL     71 - 140
CPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYA    141 - 210
PPRDFAAYRS                                                                211 - 220
//

Text Mined References (287)

PMID Year Title
26950734 2016 Loss of CD28 on Peripheral T Cells Decreases the Risk for Early Acute Rejection after Kidney Transplantation.
26885860 2016 Distinct Signaling of Coreceptors Regulates Specific Metabolism Pathways and Impacts Memory Development in CAR T Cells.
26408701 2015 Individual and Combined Effects of CTLA4-CD28 Variants and Oxidant-Antioxidant Status on the Development of Colorectal Cancer.
26405154 2015 A highly recurrent novel missense mutation in CD28 among angioimmunoblastic T-cell lymphoma patients.
26403483 2015 CTLA-4 and CD28 genes' polymorphisms and renal cell carcinoma susceptibility in the Polish population--a prospective study.
26375412 2015 CD4+CD28null T cells in acute coronary syndrome: lower with ST-elevation myocardial infarction.
26277688 Aging-associated subpopulations of human CD8+ T-lymphocytes identified by their CD28 and CD57 phenotypes.
26215444 2015 Roles of the programmed cell death 1, T cell immunoglobulin mucin-3, and cluster of differentiation 288 pathways in the low reactivity of invariant natural killer T cells after chronic hepatitis B virus infection.
26043137 2015 Vav1 Regulates T-Cell Activation through a Feedback Mechanism and Crosstalk between the T-Cell Receptor and CD28.
26041540 2015 CD58/CD2 Is the Primary Costimulatory Pathway in Human CD28-CD8+ T Cells.
More...