Property Summary

NCBI Gene PubMed Count 19
PubMed Score 23.04
PubTator Score 16.13

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

AA Sequence

MSSAARSRLTRATRQEMLFLALLLLPVVVAFARAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHC      1 - 70
PTAQLIATLKNGRKICLDLQALLYKKIIKEHLES                                         71 - 104
//

Text Mined References (20)

PMID Year Title