Property Summary

Ligand Count 1
NCBI Gene PubMed Count 37
PubMed Score 47.88
PubTator Score 100.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Abortion, Spontaneous 109 0.0 0.0
Disease Target Count
Spontaneous abortion 113
Disease Target Count P-value
malignant mesothelioma 3232 1.2e-07
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Seminoma 15 5.058 2.5
Mucinous cystadenocarcinoma 4 3.052 1.5

Gene RIF (4)

AA Sequence

MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTA      1 - 70
ARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQC     71 - 140
NTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYAHTVNRNWYSDADVPASARQEGCQDIATQLI    141 - 210
SNMDIDVILGGGRKYMFPMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQASLDPS    211 - 280
VTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALLLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTET    281 - 350
IMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVL    351 - 420
KDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPY    421 - 490
TACDLAPRAGTTDAAHPGPSVVPALLPLLAGTLLLLGTATAP                                491 - 532
//

Text Mined References (38)

PMID Year Title