Property Summary

NCBI Gene PubMed Count 37
Grant Count 62
R01 Count 49
Funding $15,735,347.97
PubMed Score 48.01
PubTator Score 100.33

Knowledge Summary

Patent

No data available

Synonym

Accession P10696 A8KAF2 Q16727 Q53S81 Q96CM1
Symbols ALPG
GCAP
ALPPL

Gene

PANTHER Protein Class (2)

MLP Assay (16)

AID Type Active / Inconclusive / Inactive Description
690 confirmatory 82 / 0 / 95782 Luminescent assay for HTS discovery of chemical inhibitors of placental alkaline phosphatase
696 confirmatory 1178 / 0 / 94561 Luminescent assay for HTS discovery of chemical activators of placental alkaline phosphatase
1017 confirmatory 24 / 0 / 43 Luminescent assay for identification of inhibitors of human intestinal alkaline phosphatase
1512 confirmatory 96 / 0 / 178 Luminescent assay for HTS discovery of chemical inhibitors of placental alkaline phosphatase confirmation
1577 summary 2 / 0 / 0 Summary luminescent assay for discovery of chemical inhibitors of placental alkaline phosphatase
488878 confirmatory 74 / 0 / 29 Dose Response confirmation of uHTS activators of Mouse Intestinal Alkaline Phosphatase using Placental Alkaline Phosphatase
488879 confirmatory 35 / 0 / 99 Dose Response confirmation of uHTS inhibitors of Mouse Intestinal Alkaline Phosphatase using Placental Alkaline Phosphatase
488888 confirmatory 96 / 0 / 3 Dose Response confirmation of uHTS activators of Human Intestinal Alkaline Phosphatase using Placental Alkaline Phosphatase
488892 confirmatory 21 / 0 / 2 Dose Response confirmation of uHTS inhibitors of Human Intestinal Alkaline Phosphatase using Placental Alkaline Phosphatase
493126 confirmatory 34 / 0 / 23 SAR analysis of small molecule activators of Human Intestinal Alkaline Phosphatase using Placental Alkaline Phosphatase
More...

Gene RIF (4)

PMID Text
23467613 aptamer-mediated identification of ALPPL-2 on the cell surface and cell secretions of pancreatic cancer cells supports its potential use in the serum- and membrane-based diagnosis of PDAC
17009260 Premature induction of hypertrophy-related molecules (type X collagen and matrix metalloproteinase 13) occurred before production of type II collagen and was followed by up-regulation of alkaline phosphatase activity.
16412386 These results indicate that IAP is strongly involved in chylomicron formation and fatty acid metabolism might change among ABO blood type.
12372831 the structural differences in human AP isoforms are demonstrated through models

AA Sequence

MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTA      1 - 70
ARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQC     71 - 140
NTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYAHTVNRNWYSDADVPASARQEGCQDIATQLI    141 - 210
SNMDIDVILGGGRKYMFPMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQASLDPS    211 - 280
VTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALLLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTET    281 - 350
IMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVL    351 - 420
KDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPY    421 - 490
TACDLAPRAGTTDAAHPGPSVVPALLPLLAGTLLLLGTATAP                                491 - 532
//

Text Mined References (38)

PMID Year Title
23467613 2013 Alkaline phosphatase ALPPL-2 is a novel pancreatic carcinoma-associated protein.
17009260 2006 Premature induction of hypertrophy during in vitro chondrogenesis of human mesenchymal stem cells correlates with calcification and vascular invasion after ectopic transplantation in SCID mice.
16412386 2006 Involvement of intestinal alkaline phosphatase in serum apolipoprotein B-48 level and its association with ABO and secretor blood group types.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12372831 2002 Structural evidence of functional divergence in human alkaline phosphatases.
11937510 2002 Function assignment to conserved residues in mammalian alkaline phosphatases.
More...