Property Summary

NCBI Gene PubMed Count 206
Grant Count 300
R01 Count 185
Funding $36,282,901.41
PubMed Score 1198.83
PubTator Score 1091.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (52)

Disease Z-score Confidence
Disseminated intravascular coagulation 32 5.046 2.5
Cerebrovascular disease 231 4.138 2.1
Coronary artery disease 240 3.904 2.0
Atherosclerosis 275 3.417 1.7
Cancer 2,346 3.364 1.7
Factor VII deficiency 5 3.0 1.5
Activated Protein C Resistance 2
Airway Obstruction 3
Anoxia 33
Atopic dermatitis 944
Barrett's esophagus 183
Duchenne muscular dystrophy 602
Hydrolethalus syndrome 128
IGA Glomerulonephritis 454
Juvenile arthritis 124
Purpura, Thrombotic Thrombocytopenic 4
Venous Thrombosis 21
acute quadriplegic myopathy 1,157
aldosterone-producing adenoma 664
astrocytoma 1,493
atypical teratoid / rhabdoid tumor 4,369
breast carcinoma 1,614
colon cancer 1,475
cystic fibrosis 1,665
ductal carcinoma in situ 1,745
esophageal adenocarcinoma 737
fascioscapulohumeral muscular dystrophy 100
gastric carcinoma 832
glioblastoma 5,572
interstitial cystitis 2,299
interstitial lung disease 291
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
non primary Sjogren syndrome sicca 840
non-inflammatory breast cancer 208
non-small cell lung cancer 2,798
ovarian cancer 8,484
pancreatic cancer 2,300
pancreatic carcinoma 567
pancreatic ductal adenocarcinoma liver m... 1,795 
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
pituitary cancer 1,972
posterior fossa group A ependymoma 1,511
primitive neuroectodermal tumor 3,031
psoriasis 6,685
tuberculosis and treatment for 3 months 327
ulcerative colitis 2,087

Expression

Synonym

Accession P10646 O95103 Q53TS4 TFPI
Symbols EPI
TFI
LACI
TFPI1

Gene

PDB

1ADZ   1IRH   1TFX   4BQD   4DTG  

 GWAS Trait (1)

Gene RIF (170)

PMID Text
26999742 ERalpha can interact with all three ERE half-sites in the TFPI 5'-flanking region.
26681757 Tissue factor pathway inhibitor activity and APC resistance are related to coronary heart disease risk in women, but may not explain the increased CHD risk due to estrogen plus progestin therapy.
26496276 Tissue factor pathway inhibitor-2 gene polymorphisms were associated with coronary atherosclerosis in the Chinese population
26233570 Association between genetic polymorphisms and deep vein thrombosis in a Chinese population.
26163243 coagulation system, TFPI play an important role in the pathogenesis of CRSwNP.
25882602 This study indicates that genetic and phenotypic variation of both TFPIalpha and TFPIbeta, more than TF, are markers of cancer progression.
25879386 rs5940 and rs7586970 moderate TFPI plasma levels and are candidate risk factors for thrombosis, but the regulation of TFPI plasma levels involves genetic factors beyond the TFPI gene. Review.
25864889 TNFalpha and Stx-1 compared to TNFalpha alone leads to an increase in procoagulant TF on endothelial cells, which is explained by a significant decrease in TFPI not co-localized with TF and not to an increase in TF not co-localized with TFPI
25712553 A significant degradation of TFPI was induced by ROS exposure, resulting in a decreased ability to bind FXa. ROS induce a procoagulant state in endothelial cells by altering TFPI structure, resulting in inhibition of TFPI binding to Factor Xa
25617766 Syndecan-3 and TFPI colocalize on the surface of endothelial-, smooth muscle-, and cancer cells
More...

AA Sequence

MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRF      1 - 70
FFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITR     71 - 140
YFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFE    141 - 210
FHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGL    211 - 280
IKTKRKRKKQRVKIAYEEIFVKNM                                                  281 - 304
//

Text Mined References (208)

PMID Year Title
26999742 2016 Oestrogens Downregulate Tissue Factor Pathway Inhibitor through Oestrogen Response Elements in the 5'-Flanking Region.
26681757 2016 Tissue Factor Pathway Inhibitor, Activated Protein C Resistance, and Risk of Coronary Heart Disease Due To Combined Estrogen Plus Progestin Therapy.
26603155 2016 Tissue Factor Pathway Inhibitor: Multiple Anticoagulant Activities for a Single Protein.
26496276 2015 Tissue Factor Pathway Inhibitor-2 Gene Polymorphisms Associate With Coronary Atherosclerosis in Chinese Population.
26233570 2015 Association between genetic polymorphisms and deep vein thrombosis in a Chinese population.
26163243 Tissue factor and tissue factor pathway inhibitor in nasal mucosa and nasal secretions of chronic rhinosinusitis with nasal polyp.
25882602 2015 Tumor expression, plasma levels and genetic polymorphisms of the coagulation inhibitor TFPI are associated with clinicopathological parameters and survival in breast cancer, in contrast to the coagulation initiator TF.
25879386 2015 Genetic determinants of tissue factor pathway inhibitor plasma levels.
25864889 2015 Shiga toxin-1 Decreases Endothelial Cell Tissue Factor Pathway Inhibitor Not Co-localized with Tissue Factor on the Cell Membrane.
25712553 2015 Reactive oxygen species induce a procoagulant state in endothelial cells by inhibiting tissue factor pathway inhibitor.
More...