Property Summary

NCBI Gene PubMed Count 219
PubMed Score 1227.89
PubTator Score 1091.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Juvenile arthritis 126
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 0.7

Expression

  Differential Expression (39)

Disease log2 FC p
acute quadriplegic myopathy 1.270 2.5e-05
adult high grade glioma 1.800 1.9e-04
aldosterone-producing adenoma -1.205 7.5e-03
astrocytoma 1.500 1.5e-06
Astrocytoma, Pilocytic 2.200 2.1e-05
Atopic dermatitis -1.200 4.4e-03
atypical teratoid / rhabdoid tumor 3.400 2.5e-04
Barrett's esophagus 1.200 4.4e-02
breast carcinoma -1.600 1.4e-04
colon cancer -1.400 8.4e-03
cystic fibrosis -1.269 1.7e-04
Duchenne muscular dystrophy 1.319 7.8e-07
ductal carcinoma in situ -1.100 3.9e-02
esophageal adenocarcinoma 1.500 1.8e-02
fascioscapulohumeral muscular dystrophy 1.101 2.3e-03
gastric carcinoma 2.000 1.9e-02
glioblastoma 2.300 1.2e-05
Hydrolethalus syndrome 3.488 3.6e-02
interstitial cystitis 1.100 1.7e-03
interstitial lung disease -1.200 1.5e-02
invasive ductal carcinoma -1.076 2.8e-03
juvenile dermatomyositis 1.442 3.5e-11
lung adenocarcinoma -1.200 2.0e-08
lung cancer -3.200 6.6e-06
lung carcinoma -3.400 1.4e-35
malignant mesothelioma -4.400 1.5e-08
non primary Sjogren syndrome sicca -1.100 1.7e-02
non-inflammatory breast cancer -1.400 4.7e-02
non-small cell lung cancer -1.698 1.6e-09
ovarian cancer -1.100 4.7e-06
pancreatic cancer 1.600 1.0e-04
pancreatic carcinoma 1.600 1.0e-04
pancreatic ductal adenocarcinoma liver m... -1.473 1.6e-02
pituitary cancer -1.700 5.8e-08
posterior fossa group A ependymoma 1.100 8.5e-06
primitive neuroectodermal tumor 2.400 4.2e-03
psoriasis 1.400 1.8e-02
tuberculosis -2.900 5.0e-07
ulcerative colitis 1.600 7.0e-04

Protein-protein Interaction (1)

Gene RIF (184)

AA Sequence

MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRF      1 - 70
FFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITR     71 - 140
YFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFE    141 - 210
FHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGL    211 - 280
IKTKRKRKKQRVKIAYEEIFVKNM                                                  281 - 304
//

Text Mined References (221)

PMID Year Title