Property Summary

NCBI Gene PubMed Count 206
PubMed Score 1198.83
PubTator Score 1091.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 1.43856162106194E-35
breast carcinoma 1614 1.8616091213714E-28
non-small cell lung cancer 2798 9.35542001413997E-14
ovarian cancer 8492 5.85630448601116E-13
juvenile dermatomyositis 1189 3.53473572242283E-11
malignant mesothelioma 3163 1.50138533512907E-8
lung adenocarcinoma 2714 1.9998391851132E-8
tuberculosis and treatment for 3 months 327 5.6303855361571E-8
pediatric high grade glioma 2712 5.95052186471312E-8
pituitary cancer 1972 3.35067100814697E-7
Duchenne muscular dystrophy 602 7.78883083068426E-7
astrocytoma 1493 1.45849220580727E-6
ulcerative colitis 2087 3.06324967657551E-6
cystic fibrosis 1670 4.94509916263912E-6
pilocytic astrocytoma 3086 5.49168500063235E-6
lung cancer 4473 6.6358233997015E-6
acute quadriplegic myopathy 1157 2.48016270366724E-5
pancreatic carcinoma 567 1.01843295525697E-4
pancreatic cancer 2300 1.01843295525698E-4
glioblastoma 5572 1.82783470350553E-4
atypical teratoid / rhabdoid tumor 4369 2.45580570284302E-4
posterior fossa group A ependymoma 1511 3.32715209517058E-4
invasive ductal carcinoma 2950 3.56443477359617E-4
interstitial cystitis 2299 5.92432204487732E-4
Atopic dermatitis 944 0.00214970256345211
fascioscapulohumeral muscular dystrophy 100 0.00228767131213489
primitive neuroectodermal tumor 3031 0.00421233545434654
aldosterone-producing adenoma 664 0.00901571494474983
colon cancer 1475 0.0134120543488033
interstitial lung disease 292 0.0148298783078315
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0157735867898761
non primary Sjogren syndrome sicca 840 0.0171230118803571
esophageal adenocarcinoma 737 0.0176010007179145
psoriasis 6685 0.0180472983348431
gastric carcinoma 832 0.019087298930701
Hydrolethalus syndrome 128 0.0362624571621455
ductal carcinoma in situ 1745 0.0388113613862307
Barrett's esophagus 185 0.0437503770817417
non-inflammatory breast cancer 208 0.0470189824844548

Expression

Synonym

Accession P10646 O95103 Q53TS4 TFPI
Symbols EPI
TFI
LACI
TFPI1

Gene

PDB

1ADZ   1IRH   1TFX   4BQD   4DTG  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (170)

PMID Text
26999742 ERalpha can interact with all three ERE half-sites in the TFPI 5'-flanking region.
26681757 Tissue factor pathway inhibitor activity and APC resistance are related to coronary heart disease risk in women, but may not explain the increased CHD risk due to estrogen plus progestin therapy.
26496276 Tissue factor pathway inhibitor-2 gene polymorphisms were associated with coronary atherosclerosis in the Chinese population
26233570 Association between genetic polymorphisms and deep vein thrombosis in a Chinese population.
26163243 coagulation system, TFPI play an important role in the pathogenesis of CRSwNP.
25882602 This study indicates that genetic and phenotypic variation of both TFPIalpha and TFPIbeta, more than TF, are markers of cancer progression.
25879386 rs5940 and rs7586970 moderate TFPI plasma levels and are candidate risk factors for thrombosis, but the regulation of TFPI plasma levels involves genetic factors beyond the TFPI gene. Review.
25864889 TNFalpha and Stx-1 compared to TNFalpha alone leads to an increase in procoagulant TF on endothelial cells, which is explained by a significant decrease in TFPI not co-localized with TF and not to an increase in TF not co-localized with TFPI
25712553 A significant degradation of TFPI was induced by ROS exposure, resulting in a decreased ability to bind FXa. ROS induce a procoagulant state in endothelial cells by altering TFPI structure, resulting in inhibition of TFPI binding to Factor Xa
25617766 Syndecan-3 and TFPI colocalize on the surface of endothelial-, smooth muscle-, and cancer cells
More...

AA Sequence

MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRF      1 - 70
FFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITR     71 - 140
YFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFE    141 - 210
FHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGL    211 - 280
IKTKRKRKKQRVKIAYEEIFVKNM                                                  281 - 304
//

Text Mined References (208)

PMID Year Title
26999742 2016 Oestrogens Downregulate Tissue Factor Pathway Inhibitor through Oestrogen Response Elements in the 5'-Flanking Region.
26681757 2016 Tissue Factor Pathway Inhibitor, Activated Protein C Resistance, and Risk of Coronary Heart Disease Due To Combined Estrogen Plus Progestin Therapy.
26603155 2016 Tissue Factor Pathway Inhibitor: Multiple Anticoagulant Activities for a Single Protein.
26496276 2015 Tissue Factor Pathway Inhibitor-2 Gene Polymorphisms Associate With Coronary Atherosclerosis in Chinese Population.
26233570 2015 Association between genetic polymorphisms and deep vein thrombosis in a Chinese population.
26163243 Tissue factor and tissue factor pathway inhibitor in nasal mucosa and nasal secretions of chronic rhinosinusitis with nasal polyp.
25882602 2015 Tumor expression, plasma levels and genetic polymorphisms of the coagulation inhibitor TFPI are associated with clinicopathological parameters and survival in breast cancer, in contrast to the coagulation initiator TF.
25879386 2015 Genetic determinants of tissue factor pathway inhibitor plasma levels.
25864889 2015 Shiga toxin-1 Decreases Endothelial Cell Tissue Factor Pathway Inhibitor Not Co-localized with Tissue Factor on the Cell Membrane.
25712553 2015 Reactive oxygen species induce a procoagulant state in endothelial cells by inhibiting tissue factor pathway inhibitor.
More...