Property Summary

NCBI Gene PubMed Count 209
PubMed Score 2149.25
PubTator Score 2637.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytoma -1.600 3.1e-16
posterior fossa group B ependymoma -2.700 1.5e-12
glioblastoma -1.900 5.3e-04
oligodendroglioma -1.300 9.6e-10
atypical teratoid / rhabdoid tumor -2.300 2.7e-05
adrenocortical adenoma -1.658 9.3e-03
adrenocortical carcinoma -1.567 1.3e-03
intraductal papillary-mucinous carcinoma... -1.400 2.7e-02
intraductal papillary-mucinous neoplasm ... -1.700 1.2e-02
colon cancer -3.000 9.5e-09
pancreatic cancer -1.100 3.3e-03
pediatric high grade glioma -1.700 1.7e-05
group 3 medulloblastoma 1.400 4.2e-02
pilocytic astrocytoma -2.500 2.0e-08
aldosterone-producing adenoma -3.063 1.0e-02
lung carcinoma 5.400 6.4e-68
ovarian cancer 1.200 6.2e-05
pituitary cancer 1.100 1.4e-02
psoriasis -2.100 4.3e-27

Gene RIF (182)

PMID Text
26850182 In patients with resected pancreatic neuroendocrine tumors, an elevated preoperative CgA level was negatively associated with disease-free survival and overall survival.
26683597 In astrocytes from multiple sclerosis white matter lesions the expression of chromogranin A is increased.
26556564 In both mice and men the Gly364Ser polymorphism conferred metabolic traits such as elevated HDL and lowered norepinephrine levels; it was associated with superior baroreflex function and therefore better response to stress.
26403073 Data show that chrysin suppressed cell proliferation and reducing expression of achaete-scute complex-like 1 (ASCL1) and the neuroendocrine biomarker chromogranin A (CgA).
26359267 Decreased CSF levels of chromogranin A were found in Parkinson disease patients with orthostatic hypotension.
26299616 ChrA levels were not effective in predicting outcomes or detecting recurrences of Merkel cell carcinoma.
26211667 In a Japanese population, the Ser-364 allele was associated with elevated systolic blood pressure and pulse pressure, consistent with increased arterial stiffness.
26186986 Receiver operating characteristic analyses showed that ChgA autoantibodies are valuable in the predictive diagnosis of non-small cell lung cancer (NSCLC), suggesting that serum autoantibodies to ChgA-derived peptides are promising novel markers of NSCLC
25958206 Chromogranin A (10-19) and chromogranin A (43-52) were identified as antigens for autoreactive CD8(+) T cells in Type 1 diabetes patients.
25894842 Diagnostic value of circulating chromogranin a for neuroendocrine tumors
25848973 catestatin plays an important role in the progress of acute myocardial infarction
25810338 Vasoconstriction-Inhibiting Factor (VIF), a degradation product of chromogranin A, is a vasoregulatory peptide that modulates the vasoconstrictive effects of angiotensin II by acting on the angiotensin II type 2 receptor.
25754106 Data indicate that ADP-ribosylation factor 1 (Arf1) colocalizes with chromogranin A and regulates secretion of insulin like growth factor 1 (IGF-1) and is required for anchorage dependent growth.
25651748 Report fast and reliable measurement of chromogranin A with automated KRYPTOR assay.
25532001 Chromogranin A measurements are significantly assay-dependent and caution should be applied in the interpretation of CgA measurement for assessment of neuroendocrine tumor status.
25501094 reliable pathologic and circulating maker for diagnosis of gastroenteropancreatic neuroendocrine neoplasm
25392232 The CHGA 3'-UTR C+87T disrupts an miR-107 motif, with differential effects on CHGA expression, and a cis:trans (mRNA:miR) interaction regulates the association of CHGA with BP and hypertensive nephropathy.
25275071 Plasma chromogranin A levels predict survival and tumor response in patients with advanced gastroenteropancreatic neuroendocrine tumors.
25220535 The study shows that chromogranin A is a useful marker for diagnosing pancreatic neuroendocrine tumors (pNET) in Japanese populations and for distinguishing patients with pNET from patients with other pancreatic diseases.
25174455 Patients with irritable bowel syndrome present a low density of CgA compared with controls.
25099181 High serum Chromogranin A levels are associated with pancreatic neuroendocrine tumors.
25077558 a model to explain how the chromogranin A/Catecholamine complex governs the accumulation and exocytosis of secreted amines
25012947 Letter: report diagnostic role of chromogranin A immunohistochemistry in hyalinizing trabecular tumor of the thyroid.
24821335 Report QT/heart rate variability in a genomically "humanized" chromogranin a monogenic mouse model with hyperadrenergic hypertension.
24741024 High serum Chromogranin A levels are associated with low response to chemotherapy in metastatic castration-resistant prostate cancer.
24631953 Elevated plasma catestatin levels are predictive of malignant arrhythmia in patients with acute myocardial infarction.
24523932 WE-14 is produced in pheochromocytoma and secreted into the general circulation, and elevated plasma WE-14 levels are correlated with the occurrence of this chromaffin cell tumor
24375481 chromogranin A staining involving >1% of tumor cells on prostate cancer biopsies is a predictor of distant metastases and survival in patients treated with primary radiotherapy.
24375395 High serum CHGA levels are associated with small-cell lung cancer.
24338022 Naturally occurring variants of the dysglycemic peptide pancreastatin: differential potencies for multiple cellular functions and structure-function correlation.
24260544 Chromogranin A and its fragments regulate metastatic small intestinal neuroendocrine neoplasm proliferation via the AKT pathway.
24239002 Chromogranin A is a T cell antigen in human type 1 diabetes.
24210828 Cga values were higher in erosive esophagitis patients taking proton pump inhibitors compared to controls. There was no correlation between Cga levels and treatment duration.
23956349 The diagnostic accuracy of the tumor markers CgA, PP, and glucagon for pancreatic neuroendocrine tumors in multiple endocrine neoplasia type 1 is low.
23939195 CgA and CgB have been used as general NEN biomarkers for many years, while CART has only recently been identified
23702300 The present study shows plasma CST levels in patients with moderate to severe HF were significantly elevated.
23688154 Plasma catestatin level was positively correlated with that of norepinephrine and was elevated in parallel with that of NE in the different myocardial ischemia states.
23588348 Our pilot study shows that CSF CgA levels are reduced in the early stages of Parkinson disease. CgA could therefore be a potential biomarker helpful in the diagnosis of Parkinson disease.
23573890 Chromogranin A and vesicular monoamine transporter 2 are localized in protein bodies of human locus coeruleus neurons.
23426642 The present finding lends support to the suggestion that IBS is caused by a biological abnormality, and intestinal CgA cell density may be used as a biological marker for the diagnosis of IBS.
23423580 CgA, CgB, and secretoneurin are detectable in feces, and collagenous colitis patients express higher values than patients with inflammatory bowel disease and controls. In treatment, fecal secretoneurin decreased to control levels in collagenous colitis.
23418554 Data suggest that multi-antibody assay of TTF1, Vimentin, p63 CD56, chromogranin and synaptophysin may be of special value, especially in diagnosing small biopsies.
23361940 Our findings suggest that altered PTEN, ATRX, CHGA, and CHGB expression are associated with aggressive PNET phenotype in VHL and may serve as useful adjunct prognostic markers to Ki-67 in PNETs.
23292839 the author showed that, in cutaneous basal cell carcinoma, the expression of NCAM and c-KIT was high, PDGFRA was intermediate, and chromogranin A and synaptophysin was relatively low
23271036 The physiological role of chromogranin A and its use as a tumor marker for diagnosing and monitoring neuroendocrine tumors are reviewed. Review.
23206950 age, burn size and three of four measures of plasma CgA predicted organ dysfunction
23173843 Chromogranin A serum levels were elevated (> 100 ng/ml) in 72/96 patients with hepatocellular carcinoma. Chromogranin A levels in the Barcelona staging of hepatocellular carcinoma were higher in stage D compared to stage C, to stage B, and to stage A.
23153859 Data suggest that serum chromogranin A (CgA) should not be considered a reliable marker to predict poorly differentiate cancer in the setting of initial prostate biopsy.
23105094 a common CHGA variant in an Indian population influences several biochemical parameters relevant to cardiovascular/metabolic disorders.
22720672 CgA PCR analysis detected the presence of CgA transcripts in lymph nodes without histological evidence of tumor metastasis.
22699394 The chromogranin A cell density seems to be a good diagnostic marker with high sensitivity and specificity in both the right and left colon, thus sigmoidoscopy can be used in the diagnosis of lymphocytic colitis using Chromogranin A as a marker.
22674297 Data indicate that Chromogranin A (CgA values did not correlate with other clinical prognostic factors, except age, in untreated-naive prostate cancer (PC).
22529895 CgA may serve as a useful marker in prognostic evaluation for early-stage patients with small cell carcinoma of the cervix.
22524436 Data show that plasma proteolytic fragments of chromogranin A VS-I was significantly increased compared with controls in patients with sepsis, severe sepsis, and sepsis shock.
22487376 Vasostatin-1 suppresses atrial fibrillation inducibility, likely by inhibiting ganglionated plexus function.
22449227 NCAM1, SYPT and CGA expressions are differently regulated by neuroendocrine phenotype-specific transcription factors in lung cancer cells.
22388654 CgA is partially processed differentially in various cell types; this review describes the roles of CgA and several of its derived peptides.
22343505 Chromogranin A is a reliable biomarker for gastroenteropancreatic neuroendocrine tumors.
22035982 Marathon running is associated with increased CGA levels. However, this does not seem to reflect cardiac burden but rather marathon induced stress.
21994954 Elevated baseline CgA provided prognostic information on progression-free survival and survival in patients with pancreatic neuroendocrine tumors.
21980038 our findings suggest that aberrant CgA expression in epithelial structures with FBCLD may represent an early sign of these events.
21945155 Activation of TRPV1 in BON-1 cells stimulates chromogranin A secretion
21918574 Multiple features of metabolic syndrome are under joint (pleiotropic) genetic determination, with CHGA as one such contributory locus: a common polymorphism in the promoter (G-462A) of CHGA predicts such heritable metabolic traits as BMI and leptin
21884005 Overexpression of vasostatin-1 in cardiomyocytes limits hypoxia-reoxygenation injuries at molecular level independently of endothelial cells.
21872447 catestatin peptides increased intracellular Ca(2+) mobilization and induced the phosphorylation of EGFR, Akt, extracellular signal-regulated kinase (ERK), and p38 in keratinocytes
21825034 VS-1 inhibited hypoxia-driven EC morphological changes, VE-cadherin redistribution, intercellular gap formation, tube morphogenesis, and HIF-1alpha nuclear translocation in vitro.
21558123 a series of events whereby ATP6V0A1 3'-UTR variant T+3246C functioned: ATP6V0A1 expression probably was affected through differential micro-RNA effects, altering vacuolar pH and consequently CHGA processing and exocytotic secretion.
21551321 Common genetic variation within the human CHGA promoter alters the interaction of specific factors in trans with the promoter, with LEF1 identified by proteomic analysis and confirmed by supershift
21508845 Plasma catestatin is elevated in patients with essential hypertension. The ratio of catestatin to norepinephrine was lower in patients with left ventricular hypertrophy.
21483253 Data suggest that An ascites CgA/serum CgA ratio greater than 1 produces excellent accuracy in predicting peritoneal metastases and/or retroperitoneal disease as the cause of ascites in the setting of metastatic carcinoid.
21478104 Plasma CgA concentration analysed together with histopathological assessment of tumor and the clinical picture is a useful marker in the diagnosis of neuroendocrine tumours.
21463431 In pregnant women in Osaka, Japan, salivary chromogranin A (and salivary cortisol ) was significantly suppressed in chronic high psychological stress/depression group in comparison with normal group.
21431800 The salivary CgA level was 0.91 +/- 0.20 and 0.42 +/- 0.1 pmol/ml at 7:00 a.m. in students scoring low and high, respectively, on the "severe depression" subscale, a statistically significant difference.
21362443 In vivo effects on cardiovascular variables in the rabbit
21357258 ChgA(29-42) peptide primed splenocytes proliferate in pancreatic lymph nodes and induce diabetes upon adoptive transfer into NOD mice.
21349414 Clinicians aware of the physiologic role of chromogranin A and its secretion in a variety of non-NET-related pathologic conditions can use this protein as a moderately effective tumor biomarker in the management of GEP-NETs.
21325453 These findings indicate that CGA is tonically released by the adrenal gland but do not support the usefulness of using CGA instead of cortisol for assessing the selectivity of blood sampling
21115933 Increased serum chromogranin A is associated with 5-alpha reductase inhibitor therapy in benign prostatic hyperplasia.
21080056 Recent findings implicating CgA as a modulator of the tumor microenvironment and suggesting that abnormal secretion of CgA could play important roles in tumor progression and response to therapy in cancer patients are reviewed and discussed.
21061160 Genetic variation at the CHGA locus eventuates in alterations in human renal function.
21046455 The roles of Cgs A and B in maintaining the intravesicular environment of secretory vesicles and in exocytosis, bringing together the most recent findings from adrenal chromaffin cells, are discussed.
21046454 This short review deals with investigations in neuroendocrine tumors (NETs) with antibodies against defined epitopes of chromogranins (Cgs) A and B and secretogranins (Sgs) II and III.
21046450 This review summarizes the findings and theoretical concepts around the molecular machinery used by CgA to exert this putative intracellular function.
21044118 Plasma CgA levels are increased in only a small portion of patients with hereditary head and neck paragangliomas and have limited additional value to the combination of radiological and routine biochemical assessment of patients with HNPGL.
20965217 Catestatin is an antimicrobial peptide with activity against bacteria, fungi, and malaria.
20930149 In vascular endothelium catestatin neuropeptide (CgA residues 352-372) acts as a novel angiogenic cytokine by inducing growth of new blood vessels via a basic fibroblast growth factor (bFGF)-dependent mechanism.
20833163 Data show that oxidative stress biomarkers and chromogranin A levels differ between control subjects and uremic/dialysis patients, suggesting that uremia is the major source of the increase in oxidative stress/CgA in end stage renal disease.
20807312 The results of this study suggested a role of chromogranins as modulators of disease onset in ALS pathogenesis.
20663522 Chromogranin A expression was an independent predictor of biochemical failure after prostatectomy in patients with localized prostate cancer
20663522 Observational study of gene-disease association. (HuGE Navigator)
20640434 decreased expression in sweat glands of palmoplantar pustulosis patients
20550951 In parathyroid adenomas, only CgA are expressed.
20335134 CgA was expressed in mammary carcinoma tissues but not in normal or hyperplastic tissues.
20213742 In endothelial cells VS-1 acts as a cell penetrating peptide, binding to heparan sulfate proteoglycans (HSPGs) and activating eNOS phosphorylation (Ser1179) through a PI3K-dependent, endocytosis-coupled mechanism.
20193177 Increased deposition of CGA was related to myocardial fibrosis in patients with dilated cardiomyopathy.
20172008 The results revealed that normal salivary gland produces its own CgA. Before treatment, CgA levels in saliva and serum were significantly greater in patients newly-diagnosed with PGE than controls.
20139771 Humans showed a nonlinear relationship between CHGA expression and pressor responses to environmental (cold) stress.
20113265 The present study suggested the genetic variants in the chromogranin A promoter may not involve in the onset of malignant hypertension, but the variants might play a role in the renal dysfunction in patients with IgAN-MHT
20113265 Observational study of gene-disease association. (HuGE Navigator)
20087896 Tissue CgA expression, evaluated in prostate cancer needle biopsies at diagnosis, is an independent prognostic factor of survival in prostate cancer patients.
20043075 down-regulated KLF4, CHGA, GPX3, SST and LIPF, together with up-regulated SERPINH1, THY1 and INHBA is an 8-gene signature for gastric cancer
20033364 role in the formation of secretory granules in COS-7 cells transfected with chromogranin A.
19943077 Chromogranin A role in cardiovascular disease states including essential hypertension has been recognized. It acts as a prohormone giving rise to bioactive peptides that exhibit several cardiovascular regulatory functions.
19855234 Studies indicate that CgA, pancreastatin and neurokinin A have strong prognostic value.
19794299 In patients with autoimmune Addison's disease hyperchromograninemia and hypergastrinemia occur with a prevalence of 27.5 and 22.5%, respectively.
19747727 Results indicate that GHRH functions as a trophic hormone for bronchial neuroendocrine (NET) tumors, and induces VEGF and chromogranin A secretion.
19724850 Chromogranin A, synaptophysin and CK 20 were not expressed in any basal cell carcinoma
19652998 Additional immunohistochemical detection of neuroendocrine differentiation (chromogranin-A, synaptophysin, and neural-cell adhesion molecule) in non-small cell lung cancer is presently not of prognostic importance.
19565071 The role of chromogranin A in irritable bowel syndrome. (Letter)
19520754 CHGA acts through the glomerular endothelium to regulate renal function.
19366853 It is possible to use CgA concentration as a potential marker of disease activity in hyperthyroidism.
19337629 CgA levels appear to be transiently elevated in diarrhoea predominant irritable bowel syndrome and may indentify patients who would benefit from octreotide therapy.
19321999 Describe a significant incidence of elevated serum levels of CgA either in nonmetastatic or in metastatic prostate adenocarcinoma cases.
19090560 High CgA levels can occur in inflammatory bowel disease
19058139 The increased number of cells that expressed Oct4A in prostate cancer compared to benign prostate, and in cancers of increasing grade, suggests that Oct4A/Chromogranin A co-expressing cells represent neuroendocrine cells in prostate cancer.
19017515 The reseachers found evidence of an association between a CHGA 3'-UTR polymorphism with an increased risk of hypertension, primarily in males.
19017515 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18981630 Salivary chromogranin a is a quantitative marker of affective state of patients with amyotrophic lateral sclerosis.
18832606 enhanced levels of CgA identify patients with extra-articular involvement and reveal a negative feedback loop that limits the activation of endothelial cells in RA.
18771509 Chromogranin A-, serotonin-, synaptophysin- and vascular endothelial growth factor-positive endocrine cells and the prognosis of colorectal cancer: an immunohistochemical and ultrastructural study
18724010 These findings suggest that the acute stress due to academic examinations is associated with raised salivary IgA and chromogranin A, but not cortisol.
18721831 semiquantitative immunocytochemistry for chromogranin A in amyotrophic lateral sclerosis.
18635750 CGA is a strong and independent indicator of prognosis in critically ill nonsurgical patients
18591442 Three regions contributing to catestatin, likely affecting sympathochromaffin exocytosis. At ATP6N1, variation influenced CHGA secretion and processing to catestatin. Mechanism of novel trans-QTL for sympathochromaffin activity and blood pressure.
18549351 Suppression of Pdcd4 resulted in an increased release of CgA and Sg II and was accompanied by an up-regulation of intracellular PC1.
18549247 SCLIP and SCG10 were colocalized to the Golgi apparatus of chromaffin cells in vivo and shared localization with CHGA as it transited the Golgi.
18432188 common genetic variants in the CHGA promoter may regulate heritable changes in blood pressure
18374882 Neither chromogranin A nor CD56 is associated with cardiac hypertrophy. Chromogranin A is significantly decreased by ventricular support. Sarcoplasmic colocalization of brain natriuretic peptide and chromogranin A is diminished after unloading.
18329114 Serum CgA (chromogranin A)was significantly higher in pancreatic cancer patientscompared with healthy subjects and those with chronic pancreatitis
18271679 plasma CGA concentration is an effective marker of pheochromocytoma with association to malignity and tumor mass
18262756 expression and catalytic activity of PKD2 are required for the release of chromogranin A containing secretory vesicles
18235090 common variants associate with the risk of hypertensive end-stage renal disease in blacks
18235090 Observational study of gene-disease association. (HuGE Navigator)
18158567 Chromogranin A-positive tumor cells can be detected in esophageal squamous cell carcinomas, supporting the notion that heterogeneous neuroendocrine (NE) differentiation also exists in tumors that lack NE cells in their normal epithelial counterparts.
18074379 CHGA protein might contribute to the observed phenotype.
18061980 Serum chromogranin A (CHGA) levels were higher in Rheumatoid arthritis (RA) and lupus erythematosus than in healthy subjects and density of CHGA+ cells was higher in RA synovium compared to osteoarthritis controls
18046660 Phaeochromocytomas from multiple endocrine neoplasia type 2 patients express substantially more CGA than tumours from von Hippel-Lindau patients at both the mRNA (3-fold greater) and protein (20-fold) level.
17991725 the Pro370Leu CHGA gene variant may contribute to the differential prevalence of cardiovascular disease across ethnic groups
17985422 Expression of NeuroD1 versus chromogranin-A is more frequent in pCA.
17929277 The finding that PGP 9.5 and ChA are expressed by PC-3 and DU145 cells suggests that these cells may have been derived from metastatic adenocarcinomas which had undergone neuroendocrine differentiation or expression occurred as a result of cell culture.
17889508 A pathway comprising PKCs>Raf-1>MEK-1>ERK-1/-2 mediates the effect of gastrin on the CgA promoter, and strongly suggests that enhanced phosphorylation of Sp1 and CREB is crucial for CgA transactivation through the G protein-coupled CCK-B/gastrin receptor.
17718510 These results suggest new roles for secretory protein tertiary structure in hormone and transmitter storage, with implications for secretory cargo condensation (or dense core "packing" structure) within the regulated pathway.
17599769 Increased serum levels of CgA in nonsmall cell lung cancer are independent from protein expression in tumors and more likely related to neuroendocrine response associated with worsening of patient condition.
17578828 Octreotide suppression test with CgA level assessment in NET patients is a simple, straightforward examination, providing information on the predicted response to the applied SSA and the data on initial clinical tolerance of those agents.
17510497 chromogranin A salivary levels increase with laughter
17438154 Observational study of gene-disease association. (HuGE Navigator)
17438154 The catestatin Gly364Ser variant cleaved from CHAG causes profound changes in human autonomic activity, both parasympathetic and sympathetic, and seems to reduce risk of developing hypertension, especially in men
17438153 Observational study of gene-disease association. (HuGE Navigator)
17438153 common, heritable variation in expression of the human CHGA gene influences endothelial ET-1 secretion in vivo
17438105 CgA is highly expressed in microdissected cells from carcinoid metastases and its promoter controls the adenoviral E1A gene, making it a possible agent for treating liver metastasis.
17379958 Salivary CgA levels peak upon awakening, and then quickly decrease to the nadir after 1 hour and maintained a low level throughout the day. On the other hand, plasma CgA did not show any obvious circadian rhythm.
17293489 Antiadrenergic effect of vasostatin-1 is mainly due to a phosphatidylinositol 3-kinase dependent nitric oxide release by cardiac endothelial cells.
17126478 Expression of NeuroD1 versus chromogranin-A is more frequent in pCA
17060047 The changes in salivary CgA secretion as a result of exposure to a cognitive task may indicate psychological stress in humans.
17032650 propose that CgA promotes the biogenesis of secretory granules by a mechanism involving a granulogenic determinant located within CgA-(40-115) of the mature protein
17003646 trong positive linear relationship exists between serum and plasma CGA levels in pancreatic carcinoid tumor patients.
16504480 Observational study of gene-disease association. (HuGE Navigator)
16504480 These results suggest that the CHGA gene is associated with the risk of developing schizophrenia in the Japanese population.
16450720 CgA levels may have a diagnostic, therapeutic and prognostic role in the management of prostate cancer patients.
16408221 Commercial CgA antibodies seem more useful for histopathological diagnosis of enterochromaffin-like cell neoplasms than the antibodies to the other CgA regions.
16330879 CgA was detected in secretory granules of serous and ductal cells by immunoelectron microscopy; CgA in humans is produced by HSG and secreted into saliva.
16151967 suggest vasostatins as novel cardioregulatory peptides in mammals
16007257 Rescue of elevated BP to normalcy was achieved by humanization of Chga mice.
15956083 Dysglycemic peptide pancreastatin is active in humans on multiple facets of intermediary metabolism, though is does not antagonize insulin. It is elevated in diabetes, and variant Gly297Ser had increased potency to inhibit glucose uptake.
15788643 Elevated plasma chromogranin A levels are associated with prostate cancer patients with hormone-refractory disease
15648545 In human adrenocortical adenomas CgA is not expressed, and removal of the mass does not modify plasma CgA levels. Endocrine involvement of local CgA in adrenocortical tumorigenesis is unlikely.
15542860 V-ATPase-mediated pH gradient in the secretory pathway is an important factor for the formation of dense-core granules by regulating the ability of CgA to form aggregates, a crucial step that may underlie the granulogenic function of the protein.
15462496 More chromogranin A was expressed in benign epithelial cells adjacent to adenocarcinomatic lesions than in the adenocarcinoma and in nodular hyperplasia of the prostatic gland.
15337252 The results indicate that the decrease in the number of CgA positive large dense-core vesicles per terminal, and/or in the number of CgA positive terminals, suggesting possible functional impairment of prefrontal synaptic contact in schizophrenia.
14968443 The relative risk of clinical understaging of prostatic neoplasms significantly varied according to serum CgA levels
14734634 Circulating CgA could help regulate the endothelial barrier function and to protect vessels against TNF-induced plasma leakage in pathological conditions characterized by increased production of TNF and CgA, such as cancer or heart failure.
12826904 expression and localization of chromogranin A (CgA), chromogranin B (CgB), synaptophysin, and insulin were ultrastructurally studied with the immunogold technique in porcine and human pancreatic islet neuroendocrine cells
12692477 Immunoreactive patterns of chromogranin A and B [CgA,CgB] were investigated in Creutzfeldt-Jakob disease and Alzheimer's disease. CgB, but not CgA was selectively associated with prion protein deposits, whereas CgA was only seen in amyloid beta plaques
12687271 differences in CgA and CD57 expression in human neuroendocrine tumors are related to the degree of differentiation of the neoplasms and probably reflect the degree of maturation (functional state) of neuroendocrine granules within the neoplastic cells.
12456801 studies for the first time identify Egr-1 as a nuclear target of gastrin and show that functional interplay of Egr-1, Sp1, and CREB is indispensable for gastrin-dependent CgA transactivation in gastric epithelial cells
12442257 isolation and characterization human CgA-derived peptides produced by endogenous prohormone convertases
12438152 Chromofungin is an antimicrobial peptide with antifungal activity.
12438141 WE-14 is found in the adrenal chromaffin cell population and in the enterochromaffin-like (ECL) cells of the oxyntic mucosa
12432071 identification of a novel sorting determinant for the regulated pathway
12397377 The peptides WE14 and EL35, derived from evolutionarily conserved regions of CHGA, were studied in human endocrine tissues.
12165659 CgA may play some role in the early phase of neoplastic progression
12091348 CGA and CGB were also found to have an immune origin, being present in monocytes and neutrophils during coronary artery bypass surgery, possibly due to raised IL-6 plasma levels.

AA Sequence

MRSAAVLALLLCAGQVTALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSIL      1 - 70
RHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAE     71 - 140
KSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGL    141 - 210
VDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGA    211 - 280
GKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAK    281 - 350
ELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKE    351 - 420
EEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG                                     421 - 457
//

Text Mined References (219)

PMID Year Title
26850182 2016 Chromogranin A predicts survival for resected pancreatic neuroendocrine tumors.
26683597 2016 Elevated Expression of the Cerebrospinal Fluid Disease Markers Chromogranin A and Clusterin in Astrocytes of Multiple Sclerosis White Matter Lesions.
26556564 2016 Analysis and validation of traits associated with a single nucleotide polymorphism Gly364Ser in catestatin using humanized chromogranin A mouse models.
26403073 2015 Chrysin suppresses achaete-scute complex-like 1 and alters the neuroendocrine phenotype of carcinoids.
26359267 2015 Orthostatic hypotension is associated with decreased cerebrospinal fluid levels of chromogranin A in early stage of Parkinson disease.
26299616 2015 Evaluating blood levels of neuron specific enolase, chromogranin A, and circulating tumor cells as Merkel cell carcinoma biomarkers.
26211667 2015 A common genetic variant of the chromogranin A-derived peptide catestatin is associated with atherogenesis and hypertension in a Japanese population.
26186986 2015 Autoantibodies to chromogranin A are potential diagnostic biomarkers for non-small cell lung cancer.
25958206 2015 Identification of autoreactive CD8+ T cell responses targeting chromogranin A in humanized NOD mice and type 1 diabetes patients.
25894842 2015 Diagnostic value of circulating chromogranin a for neuroendocrine tumors: a systematic review and meta-analysis.
25848973 2015 Correlation of plasma catestatin level and the prognosis of patients with acute myocardial infarction.
25810338 2015 Identification of the Vasoconstriction-Inhibiting Factor (VIF), a Potent Endogenous Cofactor of Angiotensin II Acting on the Angiotensin II Type 2 Receptor.
25754106 2015 IGF-1 drives chromogranin A secretion via activation of Arf1 in human neuroendocrine tumour cells.
25651748 2014 Comparison of the automated KRYPTOR chromogranin A assay with the DAKO ELISA.
25532001 2014 A comparison of three chromogranin A assays in patients with neuroendocrine tumours.
25501094 2014 Chromogranin A as a marker for diagnosis, treatment, and survival in patients with gastroenteropancreatic neuroendocrine neoplasm.
25392232 2015 Molecular Mechanism for Hypertensive Renal Disease: Differential Regulation of Chromogranin A Expression at 3'-Untranslated Region Polymorphism C+87T by MicroRNA-107.
25275071 2014 Plasma chromogranin A levels predict survival and tumor response in patients with advanced gastroenteropancreatic neuroendocrine tumors.
25220535 2014 Serum chromogranin A is a useful marker for Japanese patients with pancreatic neuroendocrine tumors.
25174455 2014 Increased gastric chromogranin A cell density following changes to diets of patients with irritable bowel syndrome.
25099181 2014 Chromogranin A is a reliable serum diagnostic biomarker for pancreatic neuroendocrine tumors but not for insulinomas.
25077558 2014 The interaction between chromogranin A and catecholamines governs exocytosis.
25012947 2014 Diagnostic caveats of immunoreactivity for Ki67 and chromogranin A in hyalinizing trabecular tumour of the thyroid.
24821335 2014 Cardiac electrical activity in a genomically "humanized" chromogranin a monogenic mouse model with hyperadrenergic hypertension.
24741024 2014 Chromogranin A predicts outcome in prostate cancer patients treated with abiraterone.
24723458 2014 Antioxidant properties of a human neuropeptide and its protective effect on free radical-induced DNA damage.
24631953 2014 Usefulness of catestatin to predict malignant arrhythmia in patients with acute myocardial infarction.
24523932 2014 Characterization and plasma measurement of the WE-14 peptide in patients with pheochromocytoma.
24375481 2014 Chromogranin A staining as a prognostic variable in newly diagnosed Gleason score 7-10 prostate cancer treated with definitive radiotherapy.
24375395 2014 The prognostic significance of the circulating neuroendocrine markers chromogranin A, pro-gastrin-releasing peptide, and neuron-specific enolase in patients with small-cell lung cancer.
24338022 2014 Naturally occurring variants of the dysglycemic peptide pancreastatin: differential potencies for multiple cellular functions and structure-function correlation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24260544 2013 Chromogranin A and its fragments as regulators of small intestinal neuroendocrine neoplasm proliferation.
24239002 2014 Chromogranin A is a T cell antigen in human type 1 diabetes.
24210828 2014 The effects of long-term therapy with proton pump inhibitors on meal stimulated gastrin.
23956349 2013 Low accuracy of tumor markers for diagnosing pancreatic neuroendocrine tumors in multiple endocrine neoplasia type 1 patients.
23939195 2014 The biochemical utility of chromogranin A, chromogranin B and cocaine- and amphetamine-regulated transcript for neuroendocrine neoplasia.
23702300 2013 Plasma levels and diagnostic value of catestatin in patients with heart failure.
23688154 2013 Plasma levels and potential roles of catestatin in patients with coronary heart disease.
23588348 2013 Cerebrospinal fluid levels of chromogranin A in the treatment-naïve early stage Parkinson's disease: a pilot study.
23573890 2013 Chromogranin A and vesicular monoamine transporter 2 immunolocalization in protein bodies of human locus coeruleus neurons.
23426642 2013 Reduced chromogranin A cell density in the ileum of patients with irritable bowel syndrome.
23423580 2013 Increased fecal levels of chromogranin A, chromogranin B, and secretoneurin in collagenous colitis.
23418554 2013 Simultaneous multi-antibody staining in non-small cell lung cancer strengthens diagnostic accuracy especially in small tissue samples.
23361940 2013 Altered PTEN, ATRX, CHGA, CHGB, and TP53 expression are associated with aggressive VHL-associated pancreatic neuroendocrine tumors.
23292839 2013 Expression of NCAM (CD56), chromogranin A, synaptophysin, c-KIT (CD117) and PDGFRA in normal non-neoplastic skin and basal cell carcinoma: an immunohistochemical study of 66 consecutive cases.
23271036 [Chromogranin A and neuroendocrine tumors].
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
23206950 2013 Plasma chromogranin A after severe burn trauma.
23173843 2012 Elevated serum levels of Chromogranin A in hepatocellular carcinoma.
23153859 2014 Serum levels of chromogranin A are not predictive of high-grade, poorly differentiated prostate cancer: results from an Italian biopsy cohort.
23105094 2012 Functional genetic variants of the catecholamine-release-inhibitory peptide catestatin in an Indian population: allele-specific effects on metabolic traits.
22720672 2012 Comparison of PCR-based detection of chromogranin A mRNA with traditional histological lymph node staging of small intestinal neuroendocrine neoplasia.
22699394 2012 Chromogranin A cell density as a diagnostic marker for lymphocytic colitis.
22674297 Correlation between age and Chromogranin A determination in prostate diseases.
22529895 2012 Chromogranin A (CgA) as poor prognostic factor in patients with small cell carcinoma of the cervix: results of a retrospective study of 293 patients.
22524436 2012 Development of an immunoassay for the derived-peptide of chromogranin A, vasostatin-I (1-76): assessment of severity in patients with sepsis.
22487376 2012 Antiarrhythmic effects of vasostatin-1 in a canine model of atrial fibrillation.
22449227 2012 Differences of molecular expression mechanisms among neural cell adhesion molecule 1, synaptophysin, and chromogranin A in lung cancer cells.
22388654 2012 Chromogranin A and derived peptides in health and disease.
22343505 2012 Chromogranin A is a reliable biomarker for gastroenteropancreatic neuroendocrine tumors in an Asian population of patients.
22035982 2012 Extreme exercise enhances chromogranin A levels correlating with stress levels but not with cardiac burden.
21994954 2011 Chromogranin A and neuron-specific enolase as prognostic markers in patients with advanced pNET treated with everolimus.
21980038 Aberrant expression of chromogranin A, miR-146a, and miR-146b-5p in prostate structures with focally disrupted basal cell layers: an early sign of invasion and hormone-refractory cancer?
21945155 2012 Thermo-sensitive transient receptor potential vanilloid channel-1 regulates intracellular calcium and triggers chromogranin A secretion in pancreatic neuroendocrine BON-1 tumor cells.
21918574 2012 Genetic variation within a metabolic motif in the chromogranin a promoter: pleiotropic influence on cardiometabolic risk traits in twins.
21884005 2012 Overexpression of vasostatin-1 protects hypoxia/reoxygenation injuries in cardiomyocytes independent of endothelial cells.
21872447 2011 Human catestatin enhances migration and proliferation of normal human epidermal keratinocytes.
21825034 2011 The vasostatin-1 fragment of chromogranin A preserves a quiescent phenotype in hypoxia-driven endothelial cells and regulates tumor neovascularization.
21558123 2011 A common genetic variant in the 3'-UTR of vacuolar H+-ATPase ATP6V0A1 creates a micro-RNA motif to alter chromogranin A processing and hypertension risk.
21551321 2011 Proteomic analysis yields an unexpected trans-acting point in control of the human sympathochromaffin phenotype.
21508845 2011 Plasma catecholamine release-inhibitory peptide catestatin in patients with essential hypertension.
21483253 2011 Serum and ascites chromogranin-A in patients with metastatic neuroendocrine tumors.
21478104 2010 Significance of plasma chromogranin A determination in neuroendocrine tumour (NET) diagnosis.
21463431 2011 Change of salivary stress marker concentrations during pregnancy: maternal depressive status suppress changes of those levels.
21431800 2011 Levels of awakening salivary CgA in response to stress in healthy subjects.
21362443 2011 The chromogranin A- derived N-terminal peptide vasostatin-I: In vivo effects on cardiovascular variables in the rabbit.
21357258 2011 Cutting edge: vasostatin-1-derived peptide ChgA29-42 is an antigenic epitope of diabetogenic BDC2.5 T cells in nonobese diabetic mice.
21349414 2011 The clinical relevance of chromogranin A as a biomarker for gastroenteropancreatic neuroendocrine tumors.
21325453 2011 Chromogranin a measurement for assessing the selectivity of adrenal venous sampling in primary aldosteronism.
21214543 2011 Catestatin, a neuroendocrine antimicrobial peptide, induces human mast cell migration, degranulation and production of cytokines and chemokines.
21115933 2010 Comparative effect of finasteride and dutasteride on chromogranin A levels.
21080056 2010 Chromogranin A and the tumor microenvironment.
21061160 2010 Naturally occurring genetic variants in human chromogranin A (CHGA) associated with hypertension as well as hypertensive renal disease.
21046455 2010 Chromogranins A and B as regulators of vesicle cargo and exocytosis.
21046454 2010 Immunohistochemical and biochemical studies with region-specific antibodies to chromogranins A and B and secretogranins II and III in neuroendocrine tumors.
21046450 2010 Chromogranin A as a crucial factor in the sorting of peptide hormones to secretory granules.
21044118 2011 Plasma chromogranin A levels are increased in a small portion of patients with hereditary head and neck paragangliomas.
20965217 2010 Reprint of: Catestatin: a multifunctional peptide from chromogranin A.
20930149 2010 The neuropeptide catestatin acts as a novel angiogenic cytokine via a basic fibroblast growth factor-dependent mechanism.
20862257 2010 Differentiation in neuroblastoma: diffusion-limited hypoxia induces neuro-endocrine secretory protein 55 and other markers of a chromaffin phenotype.
20833163 2010 Oxidative stress biomarkers and chromogranin A in uremic patients: effects of dialytic treatment.
20807312 2010 Neuronal over-expression of chromogranin A accelerates disease onset in a mouse model of ALS.
20663522 2010 Clinical significance of polymorphism and expression of chromogranin a and endothelin-1 in prostate cancer.
20640434 2010 Normal and PPP-affected palmoplantar sweat gland express neuroendocrine markers chromogranins and synaptophysin differently.
20550951 2010 Secretogranin III in human neuroendocrine tumours: a comparative immunohistochemical study with chromogranins A and B and secretogranin II.
20335134 2010 [Expression of chromogranin A in human mammary tissues].
20213742 2010 Vasostatin 1 activates eNOS in endothelial cells through a proteoglycan-dependent mechanism.
20193177 2009 [Association between expression of chromogranin A and myocardial fibrosis in patients with dilated cardiomyopathy].
20172008 2010 Alteration in chromogranin A, obestatin and total ghrelin levels of saliva and serum in epilepsy cases.
20139771 2010 Effects of chromogranin A deficiency and excess in vivo: biphasic blood pressure and catecholamine responses.
20116404 2010 Catestatin: a multifunctional peptide from chromogranin A.
20113265 2010 Common genetic variants in the chromogranin a promoter are associated with renal injury in IgA nephropathy patients with malignant hypertension.
20087896 2010 The prognostic role of immunohistochemical chromogranin a expression in prostate cancer patients is significantly modified by androgen-deprivation therapy.
20043075 2010 An 8-gene signature, including methylated and down-regulated glutathione peroxidase 3, of gastric cancer.
20033364 2009 Formation of secretory granules by chromogranins.
19943077 2010 Chromogranin A: a novel susceptibility gene for essential hypertension.
19855234 2009 Biochemical testing for neuroendocrine tumors.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
19794299 2010 Chromogranin A as a useful neuroendocrine marker in patients with autoimmune Addison's disease.
19747727 2009 Stimulatory effect of growth hormone-releasing hormone (GHRH(1-29)NH2) on the proliferation, VEGF and chromogranin A secretion by human neuroendocrine tumor cell line NCI-H727 in vitro.
19724850 2009 Aberrant expression of class III beta-tubulin in basal cell carcinoma of the skin.
19652998 2009 Clinical relevance of neuroendocrine differentiation in non-small cell lung cancer assessed by immunohistochemistry: a retrospective study on 405 surgically resected cases.
19565071 2009 The role of chromogranin A in irritable bowel syndrome.
19520754 2009 Chromogranin A regulates renal function by triggering Weibel-Palade body exocytosis.
19366853 2009 Serum chromogranin A concentration in hyperthyroidism before and after medical treatment.
19337629 2009 The role of serum chromogranin A in diarrhoea predominant irritable bowel syndrome.
19321999 2009 Distribution of high chromogranin A serum levels in patients with nonmetastatic and metastatic prostate adenocarcinoma.
19090560 2009 Plasma chromogranin a in patients with inflammatory bowel disease.
19058139 2009 Oct4A is expressed by a subpopulation of prostate neuroendocrine cells.
19017515 2008 Naturally occurring human genetic variation in the 3'-untranslated region of the secretory protein chromogranin A is associated with autonomic blood pressure regulation and hypertension in a sex-dependent fashion.
18981630 2008 Salivary chromogranin A: useful and quantitative biochemical marker of affective state in patients with amyotrophic lateral sclerosis.
18832606 2009 Circulating chromogranin A reveals extra-articular involvement in patients with rheumatoid arthritis and curbs TNF-alpha-elicited endothelial activation.
18771509 2008 Chromogranin A-, serotonin-, synaptophysin- and vascular endothelial growth factor-positive endocrine cells and the prognosis of colorectal cancer: an immunohistochemical and ultrastructural study.
18724010 2008 The effects of examination stress on salivary cortisol, immunoglobulin A, and chromogranin A in nursing students.
18721831 2009 Chromogranin peptides in amyotrophic lateral sclerosis.
18635750 2008 Prognostic value of chromogranin A at admission in critically ill patients: a cohort study in a medical intensive care unit.
18591442 2008 Heritability and genome-wide linkage in US and australian twins identify novel genomic regions controlling chromogranin a: implications for secretion and blood pressure.
18549351 2008 Knockdown of Pdcd4 results in induction of proprotein convertase 1/3 and potent secretion of chromogranin A and secretogranin II in a neuroendocrine cell line.
18549247 2008 The trans-Golgi proteins SCLIP and SCG10 interact with chromogranin A to regulate neuroendocrine secretion.
18541522 2008 Catestatin is a novel endogenous peptide that regulates cardiac function and blood pressure.
18478008 2008 Catestatin: a new member of the cutaneous defense system.
18432188 2008 Common genetic variants in the chromogranin A promoter alter autonomic activity and blood pressure.
18374882 2008 Decreased myocardial chromogranin a expression and colocalization with brain natriuretic peptide during reverse cardiac remodeling after ventricular unloading.
18329114 Elevated chromogranin A (CgA) serum levels in the patients with advanced pancreatic cancer.
18271679 2008 Chromogranin A, a member of neuroendocrine secretory proteins as a selective marker for laboratory diagnosis of pheochromocytoma.
18262756 2008 Protein kinase D2 regulates chromogranin A secretion in human BON neuroendocrine tumour cells.
18235090 2008 Chromogranin A polymorphisms are associated with hypertensive renal disease.
18158567 2007 Chromogranin A-positive tumor cells in human esophageal squamous cell carcinomas.
18074379 2008 A child with deletion (14)(q24.3q32.13) and auditory neuropathy.
18061980 2008 Increased chromogranin A levels indicate sympathetic hyperactivity in patients with rheumatoid arthritis and systemic lupus erythematosus.
18046660 2007 Chromogranin a expression in phaeochromocytomas associated with von Hippel-Lindau syndrome and multiple endocrine neoplasia type 2.
17991725 2008 Proteolytic cleavage of human chromogranin a containing naturally occurring catestatin variants: differential processing at catestatin region by plasmin.
17985422 2007 Neuroendocrine differentiation in prostate adenocarcinoma.
17929277 2007 Human prostate cancer cells express neuroendocrine cell markers PGP 9.5 and chromogranin A.
17889508 2008 Gastrin transactivates the chromogranin A gene through MEK-1/ERK- and PKC-dependent phosphorylation of Sp1 and CREB.
17718510 2007 Biogenesis of the secretory granule: chromogranin A coiled-coil structure results in unusual physical properties and suggests a mechanism for granule core condensation.
17599769 2007 Prognostic value of circulating chromogranin A and soluble tumor necrosis factor receptors in advanced nonsmall cell lung cancer.
17578828 Octreotide suppression test in diagnosing and predicting the outcome of therapy in patients with neuroendocrine tumors. Preliminary report.
17510497 2007 Effect of laughter on salivary endocrinological stress marker chromogranin A.
17438154 2007 Catecholamine release-inhibitory peptide catestatin (chromogranin A(352-372)): naturally occurring amino acid variant Gly364Ser causes profound changes in human autonomic activity and alters risk for hypertension.
17438153 2007 Heredity of endothelin secretion: human twin studies reveal the influence of polymorphism at the chromogranin A locus, a novel determinant of endothelial function.
17438105 2007 A novel chromogranin-A promoter-driven oncolytic adenovirus for midgut carcinoid therapy.
17379958 2007 Circadian rhythm of human salivary chromogranin A.
17293489 2007 Endothelium-derived nitric oxide mediates the antiadrenergic effect of human vasostatin-1 in rat ventricular myocardium.
17126478 2007 NeuroD1 expression in human prostate cancer: can it contribute to neuroendocrine differentiation comprehension?
17060047 2006 Salivary chromogranin-A as a marker of psychological stress during a cognitive test battery in humans.
17032650 2006 Secretory granule biogenesis in sympathoadrenal cells: identification of a granulogenic determinant in the secretory prohormone chromogranin A.
17003646 2006 Validation of serum versus plasma measurements of chromogranin a levels in patients with carcinoid tumors: lack of correlation between absolute chromogranin a levels and symptom frequency.
16807684 2006 Phosphoproteomic analysis of the human pituitary.
16504480 2006 Association between chromogranin A gene polymorphism and schizophrenia in the Japanese population.
16450720 2006 [Plasma chromogranin-A (CgA)--a potential marker for diagnosis, monitoring and management of prostate cancer patients].
16408221 2006 Chromogranin A in gastric neuroendocrine tumours: an immunohistochemical and biochemical study with region-specific antibodies.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16330879 2005 Expression and localization of chromogranin A gene and protein in human submandibular gland.
16199891 2005 Comparative proteomic analysis of intra- and interindividual variation in human cerebrospinal fluid.
16151967 2006 Recombinant N-terminal fragments of chromogranin-A modulate cardiac function of the Langendorff-perfused rat heart.
16007257 2005 Hypertension from targeted ablation of chromogranin A can be rescued by the human ortholog.
15956083 2005 Pancreastatin: multiple actions on human intermediary metabolism in vivo, variation in disease, and naturally occurring functional genetic polymorphism.
15788643 2005 Independent prognostic role of circulating chromogranin A in prostate cancer patients with hormone-refractory disease.
15723172 2005 New antimicrobial activity for the catecholamine release-inhibitory peptide from chromogranin A.
15648545 2004 Plasma and tissue chromogranin in patients with adrenocortical adenomas.
15542860 2005 Role of H+-ATPase-mediated acidification in sorting and release of the regulated secretory protein chromogranin A: evidence for a vesiculogenic function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15462496 2004 Augmented expression of chromogranin A and serotonin in peri-malignant benign prostate epithelium as compared to adenocarcinoma.
15337252 2004 Selective reduction of chromogranin A-like immunoreactivities in the prefrontal cortex of schizophrenic subjects: a postmortem study.
15326220 2004 The catecholamine release-inhibitory "catestatin" fragment of chromogranin a: naturally occurring human variants with different potencies for multiple chromaffin cell nicotinic cholinergic responses.
14997482 2004 Identification and characterization of phosphorylated proteins in the human pituitary.
14968443 2004 Clinical understaging in patients with prostate adenocarcinoma submitted to radical prostatectomy: predictive value of serum chromogranin A.
14759560 2004 Conformational preferences and activities of peptides from the catecholamine release-inhibitory (catestatin) region of chromogranin A.
14740315 2004 Both rare and common polymorphisms contribute functional variation at CHGA, a regulator of catecholamine physiology.
14734634 2004 Chromogranin A protects vessels against tumor necrosis factor alpha-induced vascular leakage.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12826904 2003 Cellular expression and specific intragranular localization of chromogranin A, chromogranin B, and synaptophysin during ontogeny of pancreatic islet cells: an ultrastructural study.
12692477 2003 Different chromogranin immunoreactivity between prion and a-beta amyloid plaque.
12687271 2003 Different patterns of chromogranin A and Leu-7 (CD57) expression in gastrointestinal carcinoids: immunohistochemical and confocal laser scanning microscopy study.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456801 2002 Interaction of early growth response protein 1 (Egr-1), specificity protein 1 (Sp1), and cyclic adenosine 3'5'-monophosphate response element binding protein (CREB) at a proximal response element is critical for gastrin-dependent activation of the chromogranin A promoter.
12442257 2002 The spectrum of endogenous human chromogranin A-derived peptides identified using a modified proteomic strategy.
12438152 2002 Structural and biological characterization of chromofungin, the antifungal chromogranin A (47-66)-derived peptide.
12438141 2002 WE-14, a chromogranin a-derived neuropeptide.
12432071 2002 Identification of a novel sorting determinant for the regulated pathway in the secretory protein chromogranin A.
12397377 2002 Localization and characterization of evolutionarily conserved chromogranin A-derived peptides in the rat and human pituitary and adrenal glands.
12388744 2002 Identification of a chromogranin A domain that mediates binding to secretogranin III and targeting to secretory granules in pituitary cells and pancreatic beta-cells.
12165659 2002 Chromogranin A and chromogranin B in noninvasive and invasive breast carcinoma.
12091348 2002 Presence of chromogranin-derived antimicrobial peptides in plasma during coronary artery bypass surgery and evidence of an immune origin of these peptides.
11342539 2001 Proteolytic cleavage of chromogranin A (CgA) by plasmin. Selective liberation of a specific bioactive CgA fragment that regulates catecholamine release.
10781584 2000 Formation of the catecholamine release-inhibitory peptide catestatin from chromogranin A. Determination of proteolytic cleavage sites in hormone storage granules.
9852066 1998 Phosphorylation and O-glycosylation sites of human chromogranin A (CGA79-439) from urine of patients with carcinoid tumors.
9115255 1997 Phosphorylation and O-glycosylation sites of bovine chromogranin A from adrenal medullary chromaffin granules and their relationship with biological activities.
8910482 1996 Antibacterial activity of glycosylated and phosphorylated chromogranin A-derived peptide 173-194 from bovine adrenal medullary chromaffin granules.
8617499 1996 Dispersion of chromogranin/secretogranin secretory protein family loci in mammalian genomes.
8577930 1995 Chromogranin A: current status as a precursor for bioactive peptides and a granulogenic/sorting factor in the regulated secretory pathway.
8406464 1993 Assignment of the chromogranin A (Chga) locus to homologous regions on mouse chromosome 12 and rat chromosome 6.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8120054 1994 Human chromogranin A gene. Molecular cloning, structural analysis, and neuroendocrine cell-specific expression.
8096340 1993 Chromostatin, a chromogranin A-derived bioactive peptide, is present in human pancreatic insulin (beta) cells.
7768066 1995 Chromogranin A.
7535395 1994 Molecular characterization of immunoreactivities of peptides derived from chromogranin A (GE-25) and from secretogranin II (secretoneurin) in human and bovine cerebrospinal fluid.
3814131 1987 The gene for human chromogranin A (CgA) is located on chromosome 14.
3762065 1986 Chromogranin A, B, and C in human adrenal medulla and endocrine tissues.
3718511 1986 A cloned chromogranin A (CgA) cDNA detects a 2.3Kb mRNA in diverse neuroendocrine tissues.
3704195 1986 Chromogranin from normal human adrenal glands: purification by monoclonal antibody affinity chromatography and partial N-terminal amino acid sequence.
3403545 1988 Molecular cloning and primary structure of human chromogranin A (secretory protein I) cDNA.
2830133 1988 Isolation of human pancreastatin fragment containing the active sequence from a glucagonoma.
2445752 1987 The primary structure of human chromogranin A and pancreastatin.
2165909 1990 Isolation and characterization of a tumor-derived human protein related to chromogranin A and its in vitro conversion to human pancreastatin-48.
1577173 1992 Isolation and primary structure of a novel chromogranin A-derived peptide, WE-14, from a human midgut carcinoid tumour.