Property Summary

NCBI Gene PubMed Count 209
Grant Count 123
R01 Count 55
Funding $13,541,909.6
PubMed Score 2149.25
PubTator Score 2637.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Synonym

Accession P10645 B2R9E9 Q53FA8 Q6NR84 Q96E84 Q96GL7 Q9BQB5 CgA
Symbols CGA

Gene

PANTHER Protein Class (2)

PDB

1LV4  

Gene RIF (182)

PMID Text
26850182 In patients with resected pancreatic neuroendocrine tumors, an elevated preoperative CgA level was negatively associated with disease-free survival and overall survival.
26683597 In astrocytes from multiple sclerosis white matter lesions the expression of chromogranin A is increased.
26556564 In both mice and men the Gly364Ser polymorphism conferred metabolic traits such as elevated HDL and lowered norepinephrine levels; it was associated with superior baroreflex function and therefore better response to stress.
26403073 Data show that chrysin suppressed cell proliferation and reducing expression of achaete-scute complex-like 1 (ASCL1) and the neuroendocrine biomarker chromogranin A (CgA).
26359267 Decreased CSF levels of chromogranin A were found in Parkinson disease patients with orthostatic hypotension.
26299616 ChrA levels were not effective in predicting outcomes or detecting recurrences of Merkel cell carcinoma.
26211667 In a Japanese population, the Ser-364 allele was associated with elevated systolic blood pressure and pulse pressure, consistent with increased arterial stiffness.
26186986 Receiver operating characteristic analyses showed that ChgA autoantibodies are valuable in the predictive diagnosis of non-small cell lung cancer (NSCLC), suggesting that serum autoantibodies to ChgA-derived peptides are promising novel markers of NSCLC
25958206 Chromogranin A (10-19) and chromogranin A (43-52) were identified as antigens for autoreactive CD8(+) T cells in Type 1 diabetes patients.
25894842 Diagnostic value of circulating chromogranin a for neuroendocrine tumors
More...

AA Sequence

MRSAAVLALLLCAGQVTALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSIL      1 - 70
RHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAE     71 - 140
KSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGL    141 - 210
VDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGA    211 - 280
GKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAK    281 - 350
ELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKE    351 - 420
EEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG                                     421 - 457
//

Text Mined References (219)

PMID Year Title
26850182 2016 Chromogranin A predicts survival for resected pancreatic neuroendocrine tumors.
26683597 2016 Elevated Expression of the Cerebrospinal Fluid Disease Markers Chromogranin A and Clusterin in Astrocytes of Multiple Sclerosis White Matter Lesions.
26556564 2016 Analysis and validation of traits associated with a single nucleotide polymorphism Gly364Ser in catestatin using humanized chromogranin A mouse models.
26403073 2015 Chrysin suppresses achaete-scute complex-like 1 and alters the neuroendocrine phenotype of carcinoids.
26359267 2015 Orthostatic hypotension is associated with decreased cerebrospinal fluid levels of chromogranin A in early stage of Parkinson disease.
26299616 2015 Evaluating blood levels of neuron specific enolase, chromogranin A, and circulating tumor cells as Merkel cell carcinoma biomarkers.
26211667 2015 A common genetic variant of the chromogranin A-derived peptide catestatin is associated with atherogenesis and hypertension in a Japanese population.
26186986 2015 Autoantibodies to chromogranin A are potential diagnostic biomarkers for non-small cell lung cancer.
25958206 2015 Identification of autoreactive CD8+ T cell responses targeting chromogranin A in humanized NOD mice and type 1 diabetes patients.
25894842 2015 Diagnostic value of circulating chromogranin a for neuroendocrine tumors: a systematic review and meta-analysis.
More...