Property Summary

NCBI Gene PubMed Count 57
PubMed Score 24.15
PubTator Score 450.41

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P10643 Q6P3T5 Q92489
Symbols

Gene

C7

PDB

2WCY  

Gene RIF (27)

PMID Text
26723877 Complement proteins C7 and CFH control the stemness of liver cancer cells via LSF-1 pathway.
25735751 Complement C5b-9 complex sensitizes 661W photoreceptor cells to both apoptosis and necroptosis.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of complement component 7 (C7) in primary human brain microvascular endothelial cells
23943762 Borrelial CspA binds the human terminal complement components C7 and C9 and blocks assembly and membrane insertion of the terminal complement complex (TCC).
22206826 Studies indicate that the deletion defect may be a more commonly distributed cause of C7 deficiency in Ireland.
21881993 These overall results suggest a lack of strong association with the C2 and C7 gene polymorphisms to the susceptibility of systemic lupus erythematosus in the Malaysian population.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19931914 C7 isoelectric focusing variants can determine meningococcal killing in the early stage of infection when antibody-independent killing prevails.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19864026 Complement C5b-9 induce a JNK/Bid-dependent and JNK-independent necrotic cell death.
19834535 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19419965 Data show that the two C7-FIMs pack closely together with an approximate 2-fold rotational symmetry that is rarely seen in module pairs and has not been observed in FD-containing proteins.
19344414 Observational study of gene-disease association. (HuGE Navigator)
19221116 C7 is associated with multiple sclerosis pathogenesis.
19221116 Observational study of gene-disease association. (HuGE Navigator)
19179470 membrane associated C7 acts as a trap for the late complement components to control excessive inflammation induced by SC5b-9
19162005 Cell cycle induction by C5b-9 in aortic endothelial cells is RGC-32 dependent and this is in part through regulation of Akt and growth factor release.
18842294 Observational study of gene-disease association. (HuGE Navigator)
17266113 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15889368 recurrence of fulminant meningococcal disease in a complement component C7-deficient patient
15879120 The interaction between the factor I domain of C7 and the C345C domain at the C terminus of the C5 alpha-chain plays an essential role in complement membrane attack complex formation and complement lytic activity.
15383587 A model is suggested for an irreversible membrane attack complex assembly in which the complement 7 factor I modules, but not those in complement 6, are bound to the C345C (netrin receptor) domain of complement 5 within the fully assembled complex.
12595902 To determine transcriptional regulation of the human complement component C7, a 1 kb promoter fragment was cloned and the transcription start site was determined. C7 is expressed by the hepatoma-derived cell line Hep-3B, but not by Hep-G2.

AA Sequence

MKVISLFILVGFIGEFQSFSSASSPVNCQWDFYAPWSECNGCTKTQTRRRSVAVYGQYGGQPCVGNAFET      1 - 70
QSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCEDSERRPSCDIDKPPPNIELT     71 - 140
GNGYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLSGNVLSYTFQVKINNDFNYEFYNSTWSYVKH    141 - 210
TSTEHTSSSRKRSFFRSSSSSSRSYTSHTNEIHKGKSYQLLVVENTVEVAQFINNNPEFLQLAEPFWKEL    211 - 280
SHLPSLYDYSAYRRLIDQYGTHYLQSGSLGGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSS    281 - 350
HGCKELENALKAASGTQNNVLRGEPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQK    351 - 420
LTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPYTFGAACEQGV    421 - 490
LVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETTESTQCEDEELEHLRLLEPHC    491 - 560
FPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCNEGYSLIGNPVARCGEDLRWLVGEMHCQKIA    561 - 630
CVLPVLMDGIQSHPQKPFYTVGEKVTVSCSGGMSLEGPSAFLCGSSLKWSPEMKNARCVQKENPLTQAVP    631 - 700
KCQRWEKLQNSRCVCKMPYECGPSLDVCAQDERSKRILPLTVCKMHVLHCQGRNYTLTGRDSCTLPASAE    701 - 770
KACGACPLWGKCDAESSKCVCREASECEEEGFSICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAA    771 - 840
ETQ                                                                       841 - 843
//

Text Mined References (60)

PMID Year Title
27852032 2016 Complement component 7 (C7), a potential tumor suppressor, is correlated with tumor progression and prognosis.
27840920 2016 Depletion of complement system immunity in patients with myocardial infarction.
26841837 2016 Structural basis of complement membrane attack complex formation.
26723877 2016 Complement proteins C7 and CFH control the stemness of liver cancer cells via LSF-1.
25735751 2015 Exposure to the complement C5b-9 complex sensitizes 661W photoreceptor cells to both apoptosis and necroptosis.
24798009 2014 Structural biology of the membrane attack complex.
23943762 2013 CspA from Borrelia burgdorferi inhibits the terminal complement pathway.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22773339 2012 Complement genetics, deficiencies, and disease associations.
22206826 2012 Characterization of a large genomic deletion in four Irish families with C7 deficiency.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
22028381 2011 Quantitative detection of single amino acid polymorphisms by targeted proteomics.
21881993 2012 Complement components 2 and 7 (C2 and C7) gene polymorphisms are not major risk factors for SLE susceptibility in the Malaysian population.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19931914 2010 Complement factor 7 gene mutations in relation to meningococcal infection and clinical recurrence of meningococcal disease.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19864026 2009 Involvement of the c-jun N-terminal kinases JNK1 and JNK2 in complement-mediated cell death.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19419965 2009 Solution structure of factor I-like modules from complement C7 reveals a pair of follistatin domains in compact pseudosymmetric arrangement.
19344414 2009 Risk of non-Hodgkin lymphoma in association with germline variation in complement genes.
19221116 2009 Use of a genetic isolate to identify rare disease variants: C7 on 5p associated with MS.
19179470 2009 C7 is expressed on endothelial cells as a trap for the assembling terminal complement complex and may exert anti-inflammatory function.
19162005 2009 Response gene to complement 32 is required for C5b-9 induced cell cycle activation in endothelial cells.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
18842294 2008 Association between the SERPING1 gene and age-related macular degeneration: a two-stage case-control study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17266113 2007 Evidence for association between multiple complement pathway genes and AMD.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15889368 2005 FcgammaRIIIb and complement component C7 codeficiency in a patient with recurrence of fulminant meningococcal septic shock.
15879120 2005 Recombinant C345C and factor I modules of complement components C5 and C7 inhibit C7 incorporation into the complement membrane attack complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383587 2004 Complement components C5 and C7: recombinant factor I modules of C7 bind to the C345C domain of C5.
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
12595902 2003 Cloning and characterization of human complement component C7 promoter.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11378347 2001 Reduction in the local expression of complement component 6 (C6) and 7 (C7) mRNAs in oesophageal carcinoma.
10886241 2000 The endothelium is an extrahepatic site of synthesis of the seventh component of the complement system.
10882776 2000 Expression of complement messenger RNAs by human endothelial cells.
10551839 1999 The four terminal components of the complement system are C-mannosylated on multiple tryptophan residues.
9856499 1998 Complement C7 deficiency: seven further molecular defects and their associated marker haplotypes.
9218625 1997 Molecular bases of C7 deficiency: three different defects.
8892662 1996 Genetic bases of human complement C7 deficiency.
8871666 1996 Molecular bases of combined subtotal deficiencies of C6 and C7: their effects in combination with other C6 and C7 deficiencies.
8814254 1996 Organ-specific contribution to circulating C7 levels by the bone marrow and liver in humans.
8364540 1993 A physical map of the C6 and C7 complement component gene region on chromosome 5p13.
8345200 1993 Clusterin, the human apolipoprotein and complement inhibitor, binds to complement C7, C8 beta, and the b domain of C9.
7814888 1995 Complement component C7 is a plasminogen-binding protein.
7730625 1995 Structure of the human C7 gene and comparison with the C6, C8A, C8B, and C9 genes.
7523157 1994 Hereditary deficiency of the seventh component of complement and recurrent meningococcal infection: investigations of an Irish family using a novel haemolytic screening assay for complement activity and C7 M/N allotyping.
3335508 1988 The structure of human complement component C7 and the C5b-7 complex.
3052276 1988 Molecular organization and function of the complement system.
2792129 1989 Familial deficiency of the seventh component of complement associated with recurrent meningococcal infections.
1672663 1991 DNA polymorphisms and linkage relationship of the human complement component C6, C7, and C9 genes.
1517503 1992 Fatal pyoderma gangrenosum in association with C7 deficiency.
1387399 1992 Formation and structure of the C5b-7 complex of the lytic pathway of complement.