Property Summary

NCBI Gene PubMed Count 60
PubMed Score 24.34
PubTator Score 450.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (25)

Disease log2 FC p
active ulcerative colitis 1.009 4.9e-02
adrenocortical adenoma -1.234 2.8e-02
adrenocortical carcinoma -1.921 2.7e-03
Astrocytoma, Pilocytic 1.500 5.4e-03
Atopic dermatitis -1.900 3.6e-03
breast carcinoma -1.100 2.3e-07
colon cancer -3.400 8.1e-05
diabetes mellitus -1.400 2.8e-02
group 3 medulloblastoma 1.900 3.1e-04
intraductal papillary-mucinous adenoma (... -5.000 4.4e-05
intraductal papillary-mucinous carcinoma... -6.300 5.8e-06
intraductal papillary-mucinous neoplasm ... -6.000 5.0e-04
invasive ductal carcinoma -3.100 8.3e-03
lung adenocarcinoma -1.500 5.5e-05
lung cancer -1.500 3.4e-04
lung carcinoma -3.200 1.3e-15
mucosa-associated lymphoid tissue lympho... 2.304 2.0e-02
non-small cell lung cancer -3.570 4.1e-19
osteosarcoma -3.512 6.5e-03
ovarian cancer -4.200 4.0e-07
pancreatic cancer -1.600 3.0e-03
pancreatic ductal adenocarcinoma liver m... -1.266 2.4e-02
pituitary cancer -1.900 1.3e-02
primary Sjogren syndrome 2.600 5.9e-07
psoriasis -1.700 1.4e-04

 OMIM Phenotype (1)

Protein-protein Interaction (1)

C6  

Gene RIF (29)

AA Sequence

MKVISLFILVGFIGEFQSFSSASSPVNCQWDFYAPWSECNGCTKTQTRRRSVAVYGQYGGQPCVGNAFET      1 - 70
QSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCEDSERRPSCDIDKPPPNIELT     71 - 140
GNGYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLSGNVLSYTFQVKINNDFNYEFYNSTWSYVKH    141 - 210
TSTEHTSSSRKRSFFRSSSSSSRSYTSHTNEIHKGKSYQLLVVENTVEVAQFINNNPEFLQLAEPFWKEL    211 - 280
SHLPSLYDYSAYRRLIDQYGTHYLQSGSLGGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSS    281 - 350
HGCKELENALKAASGTQNNVLRGEPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQK    351 - 420
LTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPYTFGAACEQGV    421 - 490
LVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETTESTQCEDEELEHLRLLEPHC    491 - 560
FPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCNEGYSLIGNPVARCGEDLRWLVGEMHCQKIA    561 - 630
CVLPVLMDGIQSHPQKPFYTVGEKVTVSCSGGMSLEGPSAFLCGSSLKWSPEMKNARCVQKENPLTQAVP    631 - 700
KCQRWEKLQNSRCVCKMPYECGPSLDVCAQDERSKRILPLTVCKMHVLHCQGRNYTLTGRDSCTLPASAE    701 - 770
KACGACPLWGKCDAESSKCVCREASECEEEGFSICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAA    771 - 840
ETQ                                                                       841 - 843
//

Text Mined References (63)

PMID Year Title