Property Summary

NCBI Gene PubMed Count 57
PubMed Score 24.15
PubTator Score 450.41

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P10643 Q6P3T5 Q92489
Symbols

Gene

C7

PDB

2WCY  

Gene RIF (27)

PMID Text
26723877 Complement proteins C7 and CFH control the stemness of liver cancer cells via LSF-1 pathway.
25735751 Complement C5b-9 complex sensitizes 661W photoreceptor cells to both apoptosis and necroptosis.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of complement component 7 (C7) in primary human brain microvascular endothelial cells
23943762 Borrelial CspA binds the human terminal complement components C7 and C9 and blocks assembly and membrane insertion of the terminal complement complex (TCC).
22206826 Studies indicate that the deletion defect may be a more commonly distributed cause of C7 deficiency in Ireland.
21881993 These overall results suggest a lack of strong association with the C2 and C7 gene polymorphisms to the susceptibility of systemic lupus erythematosus in the Malaysian population.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MKVISLFILVGFIGEFQSFSSASSPVNCQWDFYAPWSECNGCTKTQTRRRSVAVYGQYGGQPCVGNAFET      1 - 70
QSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCEDSERRPSCDIDKPPPNIELT     71 - 140
GNGYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLSGNVLSYTFQVKINNDFNYEFYNSTWSYVKH    141 - 210
TSTEHTSSSRKRSFFRSSSSSSRSYTSHTNEIHKGKSYQLLVVENTVEVAQFINNNPEFLQLAEPFWKEL    211 - 280
SHLPSLYDYSAYRRLIDQYGTHYLQSGSLGGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSS    281 - 350
HGCKELENALKAASGTQNNVLRGEPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQK    351 - 420
LTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPYTFGAACEQGV    421 - 490
LVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETTESTQCEDEELEHLRLLEPHC    491 - 560
FPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCNEGYSLIGNPVARCGEDLRWLVGEMHCQKIA    561 - 630
CVLPVLMDGIQSHPQKPFYTVGEKVTVSCSGGMSLEGPSAFLCGSSLKWSPEMKNARCVQKENPLTQAVP    631 - 700
KCQRWEKLQNSRCVCKMPYECGPSLDVCAQDERSKRILPLTVCKMHVLHCQGRNYTLTGRDSCTLPASAE    701 - 770
KACGACPLWGKCDAESSKCVCREASECEEEGFSICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAA    771 - 840
ETQ                                                                       841 - 843
//

Text Mined References (60)

PMID Year Title
27852032 2016 Complement component 7 (C7), a potential tumor suppressor, is correlated with tumor progression and prognosis.
27840920 2016 Depletion of complement system immunity in patients with myocardial infarction.
26841837 2016 Structural basis of complement membrane attack complex formation.
26723877 2016 Complement proteins C7 and CFH control the stemness of liver cancer cells via LSF-1.
25735751 2015 Exposure to the complement C5b-9 complex sensitizes 661W photoreceptor cells to both apoptosis and necroptosis.
24798009 2014 Structural biology of the membrane attack complex.
23943762 2013 CspA from Borrelia burgdorferi inhibits the terminal complement pathway.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22773339 2012 Complement genetics, deficiencies, and disease associations.
More...