Property Summary

NCBI Gene PubMed Count 889
Grant Count 306
R01 Count 165
Funding $50,085,159.56
PubMed Score 3352.94
PubTator Score 3522.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.300 0.001

Synonym

Accession P10635 Q16752 Q2XND6 Q2XND7 Q2XNE0 Q6B012 Q6NXU8
Symbols CPD6
CYP2D
CYP2DL1
CYPIID6
P450C2D
P450DB1
CYP2D7AP
CYP2D7BP
CYP2D7P2
CYP2D8P2
P450-DB1

Gene

PDB

2F9Q   3QM4   3TBG   3TDA   4WNT   4WNU   4WNV   4WNW   4XRY   4XRZ  

Gene RIF (968)

PMID Text
26902503 Plasma points from 1 to 30 hours after single dose of 30-mg dextromethorphan(DM) and any plasma point at steady state after multiple doses of DM could potentially be used for phenotyping of CYP2D6.
26839488 No evidence provide for the contribution of CYP2D6 polymorphism to either drug response or CC concentrations.
26768225 The ApoE E3 allele and the CYP2D6 rs1065852 polymorphism may provide clinically relevant information for predicting therapeutic responses to donepezil therapy.
26652007 the first study to conduct functional analysis of CYP2D6 four novel high frequency alleles in Chinese Han population
26603528 CYP2D6 polymorphisms are significantly associated with therapeutic responses to donepezil in patients with Alzheimer's disease.
26551314 CYP2D6 copy number variation may account for the single most impactful genetic anomaly as it relates to pharmacogenetic directed therapies
26514968 Genotype and co-medication dependent CYP2D6 metabolic activity: effects on serum concentrations of aripiprazole, haloperidol, risperidone, paliperidone and zuclopenthixol
26510986 CYP2D6 genetic polymorphisms and phenotypes in Malaysian breast cancer patients for different ethnicities
26434912 CYP2D6 metabolism, as measured by genetic variation, can be a predictor of breast cancer outcome in Her2-neu positive women receiving tamoxifen.
26406933 CYP2D6 variants have an effect on venlafaxine metabolism in the Han Chinese population
More...

AA Sequence

MGLEALVPLAVIVAIFLLLVDLMHRRQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQLRRRFGDVFS      1 - 70
LQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLR     71 - 140
NLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLTCGRRFEYDDPRFLRLLDLAQ    141 - 210
EGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEME    211 - 280
KAKGNPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQ    281 - 350
AHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHF    351 - 420
LDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPY    421 - 490
ELCAVPR                                                                   491 - 497
//

Text Mined References (891)

PMID Year Title
26902503 2016 Alternative methods for CYP2D6 phenotyping: comparison of dextromethorphan metabolic ratios from AUC, single point plasma, and urine.
26839488 2016 Genetic Polymorphism of CYP2D6 and Clomiphene Concentrations in Infertile Patients with Ovulatory Dysfunction Treated with Clomiphene Citrate.
26768225 2016 The roles of apolipoprotein E3 and CYP2D6 (rs1065852) gene polymorphisms in the predictability of responses to individualized therapy with donepezil in Han Chinese patients with Alzheimer's disease.
26652007 2016 Functional characterization of CYP2D6 novel allelic variants identified in the Chinese Han population.
26603528 2015 Stereoselective metabolism of donepezil and steady-state plasma concentrations of S-donepezil based on CYP2D6 polymorphisms in the therapeutic responses of Han Chinese patients with Alzheimer's disease.
26551314 2016 CYP2D6 copy number distribution in the US population.
26514968 2016 Genotype and co-medication dependent CYP2D6 metabolic activity: effects on serum concentrations of aripiprazole, haloperidol, risperidone, paliperidone and zuclopenthixol.
26510986 CYP2D6 Genetic Polymorphisms and Phenotypes in Different Ethnicities of Malaysian Breast Cancer Patients.
26434912 2015 CYP2D6 Genotype and Risk of Recurrence in Tamoxifen Treated Breast Cancer Patients.
26406933 2016 Effect of CYP2D6 variants on venlafaxine metabolism in vitro.
More...