Property Summary

Ligand Count 45
NCBI Gene PubMed Count 922
PubMed Score 3484.94
PubTator Score 3522.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
diabetes mellitus 1728 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count
Neuronal ceroid lipofuscinosis 2 17

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.300 1.1e-03

PDB (12)

Gene RIF (1001)

AA Sequence

MGLEALVPLAVIVAIFLLLVDLMHRRQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQLRRRFGDVFS      1 - 70
LQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLR     71 - 140
NLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLTCGRRFEYDDPRFLRLLDLAQ    141 - 210
EGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEME    211 - 280
KAKGNPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQ    281 - 350
AHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHF    351 - 420
LDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPY    421 - 490
ELCAVPR                                                                   491 - 497
//

Text Mined References (924)

PMID Year Title