Property Summary

NCBI Gene PubMed Count 192
Grant Count 79
R01 Count 22
Funding $8,377,888.02
PubMed Score 331.06
PubTator Score 396.65

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P10632 A8K9N8 B0AZN2 B7Z1F6 Q5VX93 Q8WWB1 Q9UCZ9
Symbols CPC8
CYPIIC8
MP-12/MP-20

Gene

PDB

1PQ2   2NNH   2NNI   2NNJ   2VN0  

Gene RIF (183)

PMID Text
26507668 CYP2C8 genetic polymorphisms may influence outcome of taxane therapy in Roma and Hungarian populations.
26489615 CYP2C8-derived epoxyeicosatrienoic acids prevented TNF-alpha-induced HUVECs apoptosis via inhibition of oxidative stress associated with the Nrf2 signaling.
26427316 These comprehensive findings could inform for further genotype-phenotype studies on interindividual differences in CYP2C8-mediated drug metabolism
26404779 Significant gene-sex interaction for CYP2C8*3 with twofold increase in the relative risk of essential hypertension and a similar tendency for CYP2J2*7 associated with coronary artery disease without myocardial infarction in Bulgarian males.
26252103 Single nucleotide polymorphisms of CYP2C8,CYP2E1 and CYP4B1 are associated with susceptibility to gout in ethnic Han males population.
26161459 CYP2C8*3 is a gain-of-function polymorphism for imatinib N-demethylation, which appears to be mainly mediated by CYP2C8 and not CYP3A4 in vitro in human liver microsomes
26122864 CYP2C8 polymorphisms affected neither R- nor S-ibuprofen
26115084 the CYP2C8*3 allele has no major impact on paclitaxel metabolism in vitro or of paclitaxel-induced neuropathy
25947240 Interaction among CYP2C8, EPHX2, and CYP4A11 Gene Variants Significantly Increases the Risk for Ischemic Stroke.
25839935 Results show that CYP2C8 rs17110453 and EPHX2 rs751141 two-locus interaction confers a significantly higher risk for ischemic stroke.
More...

AA Sequence

MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKVYGPVFTVYFG      1 - 70
MNPIVVFHGYEAVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRWKEIRRFSLTTLRNFGMGKRS     71 - 140
IEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMKRFNENFRILNS    141 - 210
PWIQVCNNFPLLIDCFPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKS    211 - 280
EFNIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDA    281 - 350
VVHEIQRYSDLVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFK    351 - 420
KSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV    421 - 490
//

Text Mined References (197)

PMID Year Title
26507668 2015 Interethnic differences of cytochrome P450 gene polymorphisms may influence outcome of taxane therapy in Roma and Hungarian populations.
26489615 2015 CYP2C8-derived epoxyeicosatrienoic acids decrease oxidative stress-induced endothelial apoptosis in development of atherosclerosis: Role of Nrf2 activation.
26427316 2015 Functional characterization of 12 allelic variants of CYP2C8 by assessment of paclitaxel 6?-hydroxylation and amodiaquine N-deethylation.
26404779 2015 Gender-Specific Effect of CYP2C8*3 on the Risk of Essential Hypertension in Bulgarian Patients.
26252103 2015 [Association of single nucleotide polymorphisms of cytochrome P450 gene with susceptibility to gout in ethnic Han males from coastal regions of Shandong province].
26161459 2016 Impact of CYP2C8*3 polymorphism on in vitro metabolism of imatinib to N-desmethyl imatinib.
26122864 2015 Effect of gender and CYP2C9 and CYP2C8 polymorphisms on the pharmacokinetics of ibuprofen enantiomers.
26115084 2015 Role of cytochrome P450 2C8*3 (CYP2C8*3) in paclitaxel metabolism and paclitaxel-induced neurotoxicity.
25947240 2015 Interaction among CYP2C8, EPHX2, and CYP4A11 Gene Variants Significantly Increases the Risk for Ischemic Stroke in Chinese Populations.
25839935 2015 CYP2C8 rs17110453 and EPHX2 rs751141 two-locus interaction increases susceptibility to ischemic stroke.
More...