Property Summary

NCBI Gene PubMed Count 32
PubMed Score 197.49
PubTator Score 66.97

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

AA Sequence

MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAKKYLRTDDRVE      1 - 70
RVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIAYLTPLPQPNRALSFFVGYGV     71 - 140
TLSMAYRLLKSKLYL                                                           141 - 155
//

Text Mined References (36)

PMID Year Title