Property Summary

NCBI Gene PubMed Count 30
Grant Count 23
R01 Count 8
Funding $1,621,507.18
PubMed Score 183.58
PubTator Score 66.97

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
24486338 possibly marked variations in NB mitochondrial homeostasis, they also imply that the results of these earlier studies using NB cells are not transferable to other tumor and cell types that express MGST1 at high concentrations.
23805041 Differential expression of SOD2, ALDH1A1, and MGST1 genes in the anterior lens capsules of patients with pseudoexfoliation syndrome suggest that diseased tissue appears to respond to the previously reported oxidative stress.
23314968 The results suggest that MGST1 gene polymorphisms as one of environment gene may contribute to colorectal cancer risk in younger ages.
20727966 MGST1 protects cells (and mitochondria) by both conjugation and glutathione peroxidase functions. A new protective mechanism against cisplatin is also indicated
19343046 Observational study of gene-disease association. (HuGE Navigator)
17714764 Genes encoding KU70, MGST1 and BIK show age-related mRNA expression levels in hematopoietic stem cells.
17483957 Observational study of gene-disease association. (HuGE Navigator)
16384981 Observational study of gene-disease association. (HuGE Navigator)
15338373 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12818425 The results indicate that Sp1 is the protein mediating the basal transcription of MGST1
More...

AA Sequence

MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAKKYLRTDDRVE      1 - 70
RVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIAYLTPLPQPNRALSFFVGYGV     71 - 140
TLSMAYRLLKSKLYL                                                           141 - 155
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24486338 2014 Absence of MGST1 mRNA and protein expression in human neuroblastoma cell lines and primary tissue.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23805041 2013 Quantitative analysis of SOD2, ALDH1A1 and MGST1 messenger ribonucleic acid in anterior lens epithelium of patients with pseudoexfoliation syndrome.
23314968 2012 The role of xenobotic metabolism MGST1 gene polymorphism in colorectal cancer patients.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21269460 2011 Initial characterization of the human central proteome.
20727966 2010 Multiple roles of microsomal glutathione transferase 1 in cellular protection: a mechanistic study.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
More...