Property Summary

NCBI Gene PubMed Count 21
PubMed Score 33.44
PubTator Score 11.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.105 1.7e-04
non primary Sjogren syndrome sicca 1.200 4.7e-02
ovarian cancer 1.100 1.2e-02
pancreatic ductal adenocarcinoma liver m... -1.276 9.7e-03
ulcerative colitis -1.100 9.1e-07

Gene RIF (7)

AA Sequence

MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGA      1 - 70
SGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH                71 - 129
//

Text Mined References (25)

PMID Year Title