Property Summary

NCBI Gene PubMed Count 21
Grant Count 2
R01 Count 2
Funding $155,153.34
PubMed Score 29.23
PubTator Score 11.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.105 0.000
pancreatic ductal adenocarcinoma liver m... -1.435 0.009
non primary Sjogren syndrome sicca 1.200 0.047
ulcerative colitis -1.200 0.000
ovarian cancer 1.500 0.000

Synonym

Accession P10606 Q53YB7 Q96J18 Q99610
Symbols COXVB

Gene

PANTHER Protein Class (2)

 Grant Application (2)

Gene RIF (7)

PMID Text
26506233 silence of COX5B leads to metabolic disorders, such as increased glucose uptake and decreased lactate secretion
22917272 Transfected the A549 cells with COX Vb small interfering or shRNA and observed a significant reduction of their COX activity, oxygen consumption, ATP and ability to grow in soft agar and as poorly differentiated tumors in athymic mice.
22419111 Tat-induced mitochondrial membrane permeabilization is associated with inhibition of cytochrome c oxidase (COX) activity by Tat in disrupted mitochondria from human samples
20877624 Observational study of gene-disease association. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19834492 Data show that Bcl-2 expression positively influences the targeting of nuclear-encoded COX Va and Vb to the mitochondria of cancer cells.

AA Sequence

MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGA      1 - 70
SGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH                71 - 129
//

Text Mined References (25)

PMID Year Title
26506233 2015 Loss of COX5B inhibits proliferation and promotes senescence via mitochondrial dysfunction in breast cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22917272 2012 Cytochrome c oxidase is activated by the oncoprotein Ras and is required for A549 lung adenocarcinoma growth.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
More...