Property Summary

NCBI Gene PubMed Count 185
Grant Count 177
R01 Count 125
Funding $15,399,107.84
PubMed Score 852.47
PubTator Score 575.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus -1.400 0.025
group 3 medulloblastoma 1.700 0.000
ductal carcinoma in situ 1.100 0.045
Breast cancer -1.300 0.001

Synonym

Accession P10600 Q8WV88 TGF-beta-3
Symbols ARVD
LDS5
RNHF
ARVD1
TGF-beta3

Gene

PANTHER Protein Class (2)

PDB

1KTZ   2PJY   1TGJ   1TGK   3EO1   4UM9  

Gene RIF (146)

PMID Text
26653761 TGFbeta signaling via both SMAD2/7 and PARD6/SMURF1 pathways plays a role in trophoblast growth and differentiation.
26612435 TGFB3 polymorphism is associated with male infertility.
26555637 CCN4 has a positive influence on chondrogenic differentiation by modulating the effects of TGF-beta3.
26298390 Our study uncovers the PITX2-induced expression of TGFB1/2/3 as well as INHBA genes (p < 0.01) followed by SMAD2/3-dependent TGF-b signalling pathway in ovarian cancer cells
26184463 Results identified a novel human TGFB3 mutation, which contributes to the clinical delineation of the emerging connective tissue disorder tentatively called Rienhoff syndrome, a disorder overlapping with Marfan and Loeys-Dietz syndrome.
25858630 TGF-beta3 mediates the attenuating effect of MSCs on both the proliferation and extracellular matrix production of human keloid fibroblasts and decreases skin fibrosis
25835445 findings emphasize the broad clinical variability associated with TGFB3 mutations and highlight the importance of early recognition of the disease because of high cardiovascular risk
25753754 Fluocinolone Acetonide enhances TGF-beta3-associated chondrogenesis of bone marrow derived mesenchymal stem cells
25743244 TGFbeta1 and TGFbeta2 appeared to play a significant role in physiological and pathological conditions in the fetus.
25742744 TGF-beta3 existed in synovium and LBs of SC, and was responsible for the pathogenesis of SC.
More...

AA Sequence

MKMHLQRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPTVMTHVPYQVL      1 - 70
ALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNELAVCPKGITSKVFRFNVSSVE     71 - 140
KNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRGTAEWLSFDVTDTVRE    141 - 210
WLLRRESNLGLEISIHCPCHTFQPNGDILENIHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLIL    211 - 280
MMIPPHRLDNPGQGGQRKKRALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPY    281 - 350
LRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS            351 - 412
//

Text Mined References (185)

PMID Year Title
26653761 2016 Aberrant TGF? Signaling Contributes to Altered Trophoblast Differentiation in Preeclampsia.
26612435 2015 TGF?3 (TGFB3) polymorphism is associated with male infertility.
26555637 2016 CCN4/WISP-1 positively regulates chondrogenesis by controlling TGF-?3 function.
26315405 2015 XBP 1-Deficiency Abrogates Neointimal Lesion of Injured Vessels Via Cross Talk With the PDGF Signaling.
26298390 2015 Invasion of ovarian cancer cells is induced byPITX2-mediated activation of TGF-? and Activin-A.
26184463 2015 Exome sequencing identifies a novel heterozygous TGFB3 mutation in a disorder overlapping with Marfan and Loeys-Dietz syndrome.
25858630 2015 Mesenchymal stem cells suppress fibroblast proliferation and reduce skin fibrosis through a TGF-?3-dependent activation.
25835445 2015 Mutations in a TGF-? ligand, TGFB3, cause syndromic aortic aneurysms and dissections.
25753754 2015 Fluocinolone Acetonide Is a Potent Synergistic Factor of TGF-?3-Associated Chondrogenesis of Bone Marrow-Derived Mesenchymal Stem Cells for Articular Surface Regeneration.
25743244 2015 Constitutively high-level expression of TGF? isoforms in cord blood and its relationship to perinatal findings.
More...