Property Summary

NCBI Gene PubMed Count 198
PubMed Score 1062.54
PubTator Score 575.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
group 3 medulloblastoma 4104 4.9e-04
Breast cancer 3578 7.4e-04
diabetes mellitus 1728 2.5e-02
ductal carcinoma in situ 1745 4.5e-02
Disease Target Count Z-score Confidence
Arrhythmogenic right ventricular cardiomyopathy 30 4.216 2.1
Disease Target Count Z-score Confidence
Cardiomyopathy 116 0.0 4.0

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -1.300 7.4e-04
diabetes mellitus -1.400 2.5e-02
ductal carcinoma in situ 1.100 4.5e-02
group 3 medulloblastoma 1.700 4.9e-04

Gene RIF (156)

AA Sequence

MKMHLQRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPTVMTHVPYQVL      1 - 70
ALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNELAVCPKGITSKVFRFNVSSVE     71 - 140
KNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRGTAEWLSFDVTDTVRE    141 - 210
WLLRRESNLGLEISIHCPCHTFQPNGDILENIHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLIL    211 - 280
MMIPPHRLDNPGQGGQRKKRALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPY    281 - 350
LRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS            351 - 412
//

Text Mined References (197)

PMID Year Title