Property Summary

Ligand Count 8
NCBI Gene PubMed Count 276
PubMed Score 1494.67
PubTator Score 1655.38

Knowledge Summary


No data available


  Differential Expression (14)

Disease log2 FC p
diabetes mellitus -1.100 2.2e-02
acute quadriplegic myopathy 1.475 5.0e-06
Amyotrophic lateral sclerosis 1.017 1.8e-05
astrocytic glioma -1.200 3.6e-02
Duchenne muscular dystrophy 1.165 1.7e-06
intraductal papillary-mucinous carcinoma... 1.700 1.5e-04
intraductal papillary-mucinous neoplasm ... 2.100 2.2e-03
lung cancer 1.500 3.1e-04
lung carcinoma -1.200 5.8e-15
Multiple myeloma 1.995 3.1e-03
oligodendroglioma -1.400 3.3e-02
ovarian cancer 2.800 3.1e-05
pancreatic cancer 1.100 4.2e-06
Polycystic ovary syndrome 1.115 3.7e-02

Protein-protein Interaction (1)

Gene RIF (236)

AA Sequence

VKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV                                        71 - 105

Text Mined References (288)

PMID Year Title