Property Summary

NCBI Gene PubMed Count 249
Grant Count 861
R01 Count 503
Funding $105,888,774.47
PubMed Score 1452.14
PubTator Score 1655.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession P10599 B1ALW1 O60744 Q53X69 Q96KI3 Q9UDG5 Trx
Symbols TRX
TRDX
TRX1

Gene

TXN

PANTHER Protein Class (1)

PDB

1CQG   1CQH   4LL1   4LL4   1AIU   1AUC   1ERT   1ERU   1ERV   1ERW   1M7T   1MDI   1MDJ   1MDK   1TRS   1TRU   1TRV   1TRW   1W1C   1W1E   2HSH   2HXK   2IFQ   2IIY   3E3E   3KD0   3M9J   3M9K   3QFA   3QFB   3TRX   4OO4   4OO5   4POK   4POL   4POM   4PUF   4TRX   5DQY  

Gene RIF (212)

PMID Text
26656445 change of serum levels of thioredoxin in patients with severe traumatic brain injury
26536897 Based on its collective anti-oxidative, cytoprotective, and cytokine-like properties of TRX, TRX is likely to be involved in the optimal growth and maturation of ovarian follicles and responsiveness to hyperstimulation.
26453009 The crystal structure of fully oxidized thioredoxin shows a non-active Cys62-Cys69 disulfide bond in addition to the active Cys32-Cys35 disulfide.
26329592 genetic variants of TXN and COMT have roles in regulating abdominal obesity
26325518 Thioredoxin 1 mediates TGF-beta-induced epithelial-mesenchymal transition in salivary adenoid cystic carcinoma.
26276860 Results indicate that reduced Trx1 plays important protective roles against methyl methanesulfonate-induced DNA damage and cell death, suggesting that cell protection is regulated by the intracellular redox state.
26210445 The results demonstrate that the antiproliferative effect of NO is hampered by Trx1 and Grx1 and support the strategy of weakening the thiolic antioxidant defenses when designing new antitumoral therapies.
26119781 identification of the novel interaction between Trx1 and AIF has provided opportunities to design and develop therapeutically relevant strategies that either promote or prevent this protein-protein interaction for the treatment of different disease
26028649 MKK4 is activated in vitro by reduced Trx but not oxidized Trx in the absence of an upstream kinase, suggesting that autophosphorylation of this protein occurs due to reduction of Cys-246 and Cys-266 by Trx.
26021764 In Jurkat cells exposed to ionizing radiatin (4 Gy), constitutively active Trx systems respond to restore cellular redox balance. After 16 hrs, Trx increases and rescues cells against IR-mediated damage.
More...

AA Sequence

MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECE      1 - 70
VKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV                                        71 - 105
//

Text Mined References (261)

PMID Year Title
26656445 2016 Change of serum levels of thioredoxin in patients with severe traumatic brain injury.
26536897 2016 Thioredoxin, an antioxidant redox protein, in ovarian follicles of women undergoing in vitro fertilization.
26453009 2015 Crystal structure of fully oxidized human thioredoxin.
26329592 2015 The nutrigenetic influence of the interaction between dietary vitamin E and TXN and COMT gene polymorphisms on waist circumference: a case control study.
26325518 2015 Thioredoxin 1 mediates TGF-?-induced epithelial-mesenchymal transition in salivary adenoid cystic carcinoma.
26276860 2016 Control of Trx1 redox state modulates protection against methyl methanesulfonate-induced DNA damage via stabilization of p21.
26210445 2015 Redox regulation of metabolic and signaling pathways by thioredoxin and glutaredoxin in NOS-3 overexpressing hepatoblastoma cells.
26119781 2015 Thioredoxin-dependent regulation of AIF-mediated DNA damage.
26028649 2015 Thioredoxin Activates MKK4-NF?B Pathway in a Redox-dependent Manner to Control Manganese Superoxide Dismutase Gene Expression in Endothelial Cells.
26021764 2015 Spatio-temporal changes in glutathione and thioredoxin redox couples during ionizing radiation-induced oxidative stress regulate tumor radio-resistance.
More...