Property Summary

NCBI Gene PubMed Count 39
Grant Count 37
R01 Count 25
Funding $3,956,503.28
PubMed Score 96.69
PubTator Score 94.77

Knowledge Summary

Patent (6,217)

Expression

  Differential Expression (20)

Disease log2 FC p
urothelial carcinoma 2.200 0.009
malignant mesothelioma -4.000 0.000
osteosarcoma -2.489 0.012
cystic fibrosis -1.226 0.000
astrocytoma 1.500 0.027
Atopic dermatitis -1.200 0.001
adrenocortical carcinoma -2.341 0.000
non-small cell lung cancer -1.641 0.000
intraductal papillary-mucinous adenoma (... -2.500 0.002
intraductal papillary-mucinous carcinoma... -2.700 0.003
intraductal papillary-mucinous neoplasm ... -2.400 0.023
lung cancer -2.200 0.000
breast carcinoma -1.700 0.000
group 4 medulloblastoma -1.500 0.023
invasive ductal carcinoma -1.096 0.045
lung carcinoma -1.300 0.000
spina bifida 1.461 0.050
ovarian cancer -4.500 0.000
pituitary cancer -1.400 0.000
head and neck cancer -1.300 0.033

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (26)

PMID Text
25787832 COUP-TFII is expressed in a diverse subset of GABAergic interneurons predominantly innervating small dendritic shafts originating from both interneurons and pyramidal cells.
24906407 our mechanistic in vitro assays and in vivo results suggest that a reduction in chemokine CXCL12 expression, with an enhancement of CXCR4 expression, provoked by COUP-TFI, could be associated with an increase in the invasive potential of breast cancer
24462372 NR2F1 has an important role in the development of the visual system and that haploinsuffiency can lead to optic atrophy with intellectual impairment.
23975195 COUP-TFI and related NRs such as the COUPTFs and PNR can selectively associate with the developmental corepressor BCL11A via a conserved motif F/YSXXLXXL/Y within the RID1 and RID2 domains. The interaction with BCL11A facilitates COUP-TFII-mediated repression of the RARb2 gene.
23975195 Interaction of NSD1 with the NR2E/F subfamily including COUP-TFI, COUP-TFII, EAR2 and TLX requires an F/YSXXLXXL/Y motif. Interactions of NSD1 with liganded NRs require an overlapping LXXLL motif.
22357705 a novel mechanism of MTP repression that involves binding of NR2F1 to the DR1 element and recruitment of corepressors
20306291 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20111703 provide detailed experimental validation of each step and, as a proof of principle, utilize the methodology to identify novel direct targets of the orphan nuclear receptor NR2F1 (COUP-TFI)
20007910 Transcriptional and posttranscriptional mechanisms involving NR2F1 and IRE1beta ensure low microsomal triglyceride transfer protein expression in undifferentiated intestinal cells and avoid apolipoprotein B lipoprotein biosynthesis.
19578876 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGAGEQQQQAGSGAPHTPQTPGQPGAPATPGTAGDK      1 - 70
GQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQY     71 - 140
CRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQP    141 - 210
NNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAA    211 - 280
GLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQC    281 - 350
ALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSI    351 - 420
QCS                                                                       421 - 423
//

Text Mined References (40)

PMID Year Title
25787832 2015 Molecular and Electrophysiological Characterization of GABAergic Interneurons Expressing the Transcription Factor COUP-TFII in the Adult Human Temporal Cortex.
24906407 2014 COUP-TFI modifies CXCL12 and CXCR4 expression by activating EGF signaling and stimulates breast cancer cell migration.
24462372 2014 NR2F1 mutations cause optic atrophy with intellectual disability.
23975195 2013 A signature motif mediating selective interactions of BCL11A with the NR2E/F subfamily of orphan nuclear receptors.
22357705 2012 NR2F1 disrupts synergistic activation of the MTTP gene transcription by HNF-4? and HNF-1?.
20306291 2010 A three-stage genome-wide association study of general cognitive ability: hunting the small effects.
20111703 2010 Genome-wide analysis of binding sites and direct target genes of the orphan nuclear receptor NR2F1/COUP-TFI.
20007910 2010 NR2F1 and IRE1beta suppress microsomal triglyceride transfer protein expression and lipoprotein assembly in undifferentiated intestinal epithelial cells.
19578876 2009 The ERAP2 gene is associated with preeclampsia in Australian and Norwegian populations.
19526345 2010 Immunohistochemistry of COUP-TFI: an adjuvant diagnostic tool for the identification of corticotroph microadenomas.
More...