Property Summary

NCBI Gene PubMed Count 40
PubMed Score 106.71
PubTator Score 94.77

Knowledge Summary

Patent (6,217)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma -2.341 3.0e-06
astrocytoma 1.500 2.7e-02
Atopic dermatitis -1.200 1.1e-03
breast carcinoma -1.700 3.1e-05
cystic fibrosis -1.226 9.1e-06
group 3 medulloblastoma -1.400 3.4e-02
head and neck cancer -1.300 3.3e-02
intraductal papillary-mucinous adenoma (... -2.500 2.1e-03
intraductal papillary-mucinous carcinoma... -2.700 2.6e-03
intraductal papillary-mucinous neoplasm ... -2.400 2.3e-02
invasive ductal carcinoma -1.096 4.5e-02
lung cancer -1.500 1.7e-03
lung carcinoma -1.300 1.9e-17
malignant mesothelioma -4.000 3.0e-09
non-small cell lung cancer -1.641 2.3e-23
osteosarcoma -2.489 1.2e-02
ovarian cancer -4.500 5.8e-09
pituitary cancer -1.400 1.1e-04
spina bifida 1.461 5.0e-02
urothelial carcinoma 2.200 8.9e-03

 GO Component (2)

Gene RIF (27)

AA Sequence

MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGAGEQQQQAGSGAPHTPQTPGQPGAPATPGTAGDK      1 - 70
GQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQY     71 - 140
CRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQP    141 - 210
NNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAA    211 - 280
GLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQC    281 - 350
ALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSI    351 - 420
QCS                                                                       421 - 423
//

Text Mined References (42)

PMID Year Title