Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00
PubTator Score 27.11

Knowledge Summary

Patent (9,921)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Endometriosis 540 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count Z-score Confidence
Chronic purulent otitis media 8 3.327 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
group 4 medulloblastoma -1.100 1.3e-03
hereditary spastic paraplegia 1.155 6.3e-04
interstitial cystitis -1.100 1.4e-02
lung cancer 1.400 9.9e-04
malignant mesothelioma 1.200 9.4e-07
medulloblastoma, large-cell -1.200 7.0e-05
ovarian cancer 1.100 3.5e-04

 GO Component (2)

Protein-protein Interaction (5)

Gene RIF (5)

AA Sequence

MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV      1 - 70
FTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVA     71 - 140
ASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLL    141 - 210
FSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMD    211 - 280
QVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRF    281 - 350
GRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ                    351 - 404
//

Text Mined References (21)

PMID Year Title