Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 27.11

Knowledge Summary

Patent (9,921)

TINX Plot

  Disease Sources (3)

Disease Target Count
Endometriosis 535
Mammary Neoplasms 410
Disease Target Count P-value
malignant mesothelioma 3163 9.4386981742647E-7
ovarian cancer 8492 2.62414704792499E-6
interstitial cystitis 2299 2.79118001626756E-5
medulloblastoma, large-cell 6234 7.03211432212833E-5
hereditary spastic paraplegia 313 6.32287377578229E-4
lung cancer 4473 9.86339400069688E-4
group 4 medulloblastoma 1875 0.0012760064100544
Disease Target Count Z-score Confidence
Chronic purulent otitis media 7 3.431 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
medulloblastoma, large-cell -1.200 0.000
hereditary spastic paraplegia 1.155 0.001
lung cancer 1.400 0.001
interstitial cystitis -1.500 0.000
group 4 medulloblastoma -1.100 0.001
ovarian cancer 2.100 0.000

Synonym

Accession P10588 B2RC68 Q5XGA0 Q6P586 Q9BUE8
Symbols EAR2
EAR-2
ERBAL2

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG

  TechDev Info (2)

Steve Finkbeiner Neuron specific phenotypes being screened
Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

 GO Component (2)

Gene RIF (4)

PMID Text
23975195 EAR2/NR2F6 and related NRs such as the COUPTFs, TLX and PNR can selectively associate with the developmental corepressor BCL11A via a conserved motif F/YSXXLXXL/Y within the RID1 and RID2 domains. The interaction with BCL11A facilitates COUP-TFII-mediated repression of the RARb2 gene.
23975195 Interaction of NSD1 with the NR2E/F subfamily including COUP-TFI, COUP-TFII, EAR2 and TLX requires a F/YSXXLXXL/Y motif. NSD1 interaction with liganded NRs is mediated by an overlapping LXXLL motif.
21696885 study demonstrated that expression of EAR2 was elevated in colorectal cancer and knockdown of EAR2 reduced survivability and tumor growth of colon cancer cells
21247419 Ear2 ligand binding domain is required for Rasd1 to alleviate Ear2-mediated repression of renin transcription.

AA Sequence

MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV      1 - 70
FTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVA     71 - 140
ASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLL    141 - 210
FSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMD    211 - 280
QVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRF    281 - 350
GRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ                    351 - 404
//

Text Mined References (20)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23975195 2013 A signature motif mediating selective interactions of BCL11A with the NR2E/F subfamily of orphan nuclear receptors.
21696885 2011 The orphan nuclear receptor EAR2 is overexpressed in colorectal cancer and it regulates survivability of colon cancer cells.
21247419 2011 Rasd1 interacts with Ear2 (Nr2f6) to regulate renin transcription.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18701084 2008 The nuclear orphan receptor NR2F6 suppresses lymphocyte activation and T helper 17-dependent autoimmunity.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...