Property Summary

NCBI Gene PubMed Count 62
PubMed Score 112.39
PubTator Score 162.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
non-small cell lung cancer 2798 3.39395111056295E-17
lung adenocarcinoma 2714 1.0022068942927E-7
ulcerative colitis 2087 6.68948699844866E-6
interstitial cystitis 2299 1.27977984245461E-5
ovarian cancer 8492 2.02912237205813E-5
psoriasis 6685 3.07001134801653E-5
acute quadriplegic myopathy 1157 3.12745401176351E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 8.69984609105903E-4
lung cancer 4473 0.00128339713265001
cystic fibrosis 1670 0.00165685213744539
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00474740001895025
group 4 medulloblastoma 1875 0.00796884319871093
cutaneous lupus erythematosus 1056 0.0181341318014734
astrocytoma 1493 0.0241473039297333
adrenocortical carcinoma 1427 0.0471228957977771
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (15)

Synonym

Accession P10586 D3DPX6 D3DPX7 Q5T021 Q5T022 Q5W9G2 Q86WS0
Symbols LAR
BNAH2

Gene

PDB

1LAR   2DJU   2DN7   2EDX   2EDY   2YD5   2YD8   4N5U  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (16)

PMID Text
26291013 PTPRF may have value as a predictive marker to identify which patients can obtain the greatest benefit from erlotinib in the post-first-line setting.
24781087 Homozygous truncating PTPRF mutation causes athelia.
24470239 PTPRF is down-regulated in hepatocellular carcinoma-facilitated tumor development.
23986473 Interaction between the tripartite NGL-1, netrin-G1 and LAR adhesion complex promotes development of excitatory synapses.
20139422 Trans-synaptic adhesions between netrin-G ligand-3 (NGL-3) and receptor tyrosine phosphatases LAR, protein-tyrosine phosphatase delta (PTPdelta), and PTPsigma via specific domains regulate excitatory synapse formation.
19910497 LAR functions as a negative regulator of adipogenesis.
18925540 the PTPase activity in patients with insulin receptor gene mutation and severe insulin resistance may differ from that in ordinary type 2 diabetes
17803936 LAR and Src are identified as Death-associated protein kinase (DAPK) regulators through their reciprocal modification of DAPK Y491/492 residues and establishes a functional link of this DAPK-regulatory circuit to tumor progression.
17419996 Regulated degradation of liprinalpha1 is important for proper LAR receptor distribution, and could provide a mechanism for localized control of dendrite and synapse morphogenesis by activity and CaMKII.
17259169 PS/gamma-secretase-mediated cleavage of LAR controls LAR-beta-catenin interaction, suggesting an essential role for PS/gamma-secretase in the regulation of LAR signaling
More...

AA Sequence

MAPEPAPGRTMVPLVPALVMLGLVAGAHGDSKPVFIKVPEDQTGLSGGVASFVCQATGEPKPRITWMKKG      1 - 70
KKVSSQRFEVIEFDDGAGSVLRIQPLRVQRDEAIYECTATNSLGEINTSAKLSVLEEEQLPPGFPSIDMG     71 - 140
PQLKVVEKARTATMLCAAGGNPDPEISWFKDFLPVDPATSNGRIKQLRSGALQIESSEESDQGKYECVAT    141 - 210
NSAGTRYSAPANLYVRVRRVAPRFSIPPSSQEVMPGGSVNLTCVAVGAPMPYVKWMMGAEELTKEDEMPV    211 - 280
GRNVLELSNVVRSANYTCVAISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSGNSEPVTYY    281 - 350
GIQYRAAGTEGPFQEVDGVATTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRV    351 - 420
QARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPPNAWHKHNTDAGLLTTVGSLLPGITYSLRVLA    421 - 490
FTAVGDGPPSPTIQVKTQQGVPAQPADFQAEVESDTRIQLSWLLPPQERIIMYELVYWAAEDEDQQHKVT    491 - 560
FDPTSSYTLEDLKPDTLYRFQLAARSDMGVGVFTPTIEARTAQSTPSAPPQKVMCVSMGSTTVRVSWVPP    561 - 630
PADSRNGVITQYSVAYEAVDGEDRGRHVVDGISREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVL    631 - 700
VRTDEDVPSGPPRKVEVEPLNSTAVHVYWKLPVPSKQHGQIRGYQVTYVRLENGEPRGLPIIQDVMLAEA    701 - 770
QWRPEESEDYETTISGLTPETTYSVTVAAYTTKGDGARSKPKIVTTTGAVPGRPTMMISTTAMNTALLQW    771 - 840
HPPKELPGELLGYRLQYCRADEARPNTIDFGKDDQHFTVTGLHKGTTYIFRLAAKNRAGLGEEFEKEIRT    841 - 910
PEDLPSGFPQNLHVTGLTTSTTELAWDPPVLAERNGRIISYTVVFRDINSQQELQNITTDTRFTLTGLKP    911 - 980
DTTYDIKVRAWTSKGSGPLSPSIQSRTMPVEQVFAKNFRVAAAMKTSVLLSWEVPDSYKSAVPFKILYNG    981 - 1050
QSVEVDGHSMRKLIADLQPNTEYSFVLMNRGSSAGGLQHLVSIRTAPDLLPHKPLPASAYIEDGRFDLSM   1051 - 1120
PHVQDPSLVRWFYIVVVPIDRVGGSMLTPRWSTPEELELDELLEAIEQGGEEQRRRRRQAERLKPYVAAQ   1121 - 1190
LDVLPETFTLGDKKNYRGFYNRPLSPDLSYQCFVLASLKEPMDQKRYASSPYSDEIVVQVTPAQQQEEPE   1191 - 1260
MLWVTGPVLAVILIILIVIAILLFKRKRTHSPSSKDEQSIGLKDSLLAHSSDPVEMRRLNYQTPGMRDHP   1261 - 1330
PIPITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVILTSIDGV   1331 - 1400
PGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPARGTE   1401 - 1470
TCGLIQVTLLDTVELATYTVRTFALHKSGSSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLD   1471 - 1540
AGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAATC   1541 - 1610
GHTEVPARNLYAHIQKLGQVPPGESVTAMELEFKLLASSKAHTSRFISANLPCNKFKNRLVNIMPYELTR   1611 - 1680
VCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCH   1681 - 1750
QYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIG   1751 - 1820
QVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTVKTLRTQRPAMVQTEDQYQL   1821 - 1890
CYRAALEYLGSFDHYAT                                                        1891 - 1907
//

Text Mined References (67)

PMID Year Title
26291013 2015 PTPRF Expression as a Potential Prognostic/Predictive Marker for Treatment with Erlotinib in Non-Small-Cell Lung Cancer.
25114248 2014 Distinct isoform of FABP7 revealed by screening for retroelement-activated genes in diffuse large B-cell lymphoma.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24781087 2014 Homozygous truncating PTPRF mutation causes athelia.
24470239 2014 Functional genomics identified a novel protein tyrosine phosphatase receptor type F-mediated growth inhibition in hepatocarcinogenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23986473 2013 Trans-induced cis interaction in the tripartite NGL-1, netrin-G1 and LAR adhesion complex promotes development of excitatory synapses.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23358419 2013 Receptor protein tyrosine phosphatase-receptor tyrosine kinase substrate screen identifies EphA2 as a target for LAR in cell migration.
22959728 2013 Age of onset of amyotrophic lateral sclerosis is modulated by a locus on 1p34.1.
More...