Property Summary

NCBI Gene PubMed Count 39
Grant Count 1,103
R01 Count 698
Funding $137,195,701.5
PubMed Score 1474.25
PubTator Score 381.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.800 0.039

Synonym

Accession P10523 A0FDN6 Q53SV3 Q99858
Symbols RP47
S-AG

Gene

SAG

PANTHER Protein Class (1)

Gene RIF (18)

PMID Text
25216516 NEDD4-1 overexpression sensitizes cancer cells to etoposide-induced apoptosis by reducing SAG levels through targeted degradation. SAG is added to a growing list of NEDD4-1 substrates and mediates its biological function.
24430184 Sag is a Kras-cooperating oncogene that promotes lung tumorigenesis
23277586 Based on their observed affinity for arrestin-1, P-opsin and inactive P-Rh very likely affect the physiological monomer-dimer-tetramer equilibrium of arrestin-1, and should therefore be taken into account when modeling photoreceptor function.
22419846 Compound heterozygosity of a nonsense R193X mutation and a heterozygous deletion of 3,224 bp encompassing exon 2 in the SAG gene is the cause of Oguchi's disease in a Chinese family.
21987685 We describe a case of Oguchi disease with unusual findings caused by a putative heterozygous mutation in the SAG gene.
21922265 the arrestin 1147delA, which has been known as a frequent cause of Oguchi disease, also may be related to the pathogenesis of autosomal recessive RP.
21904838 Identification of autoantibodies specific for two retinal antigens (CRALBP and S-Ag) supports the concept of an autoimmunological origin of the disease.
21447990 Macular dysfunction can occur in Oguchi disease with the 1147delA mutation in the SAG gene.
21288033 maintenance of low levels of the active monomer is the biological role of arrestin-1 self-association
20801516 Observational study of genetic testing. (HuGE Navigator)
More...

AA Sequence

MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFR      1 - 70
YGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAP     71 - 140
QDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLA    141 - 210
VSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTK    211 - 280
TLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSE    281 - 350
VATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE                   351 - 405
//

Text Mined References (39)

PMID Year Title
25216516 2014 SAG/RBX2 is a novel substrate of NEDD4-1 E3 ubiquitin ligase and mediates NEDD4-1 induced chemosensitization.
24430184 2014 Inactivation of SAG/RBX2 E3 ubiquitin ligase suppresses KrasG12D-driven lung tumorigenesis.
23277586 2013 Involvement of distinct arrestin-1 elements in binding to different functional forms of rhodopsin.
22419846 2012 A Chinese family with Oguchi's disease due to compound heterozygosity including a novel deletion in the arrestin gene.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
21987685 2011 Oguchi disease with unusual findings associated with a heterozygous mutation in the SAG gene.
21922265 2011 Oguchi disease masked by retinitis pigmentosa.
21904838 2011 [Blind spot enlargement syndrome in acute zonal occult outer retinopathy with detection of autoantibodies against the retinal antigens CRALBP and S-Ag].
21447990 2011 Macular Dysfunction in Oguchi Disease with the Frequent Mutation 1147delA in the SAG Gene.
21288033 2011 Robust self-association is a common feature of mammalian visual arrestin-1.
More...