Property Summary

NCBI Gene PubMed Count 41
PubMed Score 1575.17
PubTator Score 381.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
medulloblastoma, large-cell 6241 3.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.800 3.9e-02

Gene RIF (19)

AA Sequence

MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFR      1 - 70
YGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAP     71 - 140
QDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLA    141 - 210
VSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTK    211 - 280
TLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSE    281 - 350
VATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE                   351 - 405
//

Text Mined References (41)

PMID Year Title