Property Summary

NCBI Gene PubMed Count 38
PubMed Score 242.50
PubTator Score 155.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (11)

Disease log2 FC p
dermatomyositis -1.200 5.8e-03
hereditary spastic paraplegia -1.298 6.8e-03
intraductal papillary-mucinous neoplasm ... 2.100 1.5e-03
lung adenocarcinoma 1.001 1.8e-06
lung cancer 1.500 2.2e-04
malignant mesothelioma 1.600 1.6e-07
medulloblastoma, large-cell 1.400 3.2e-04
non-small cell lung cancer 1.170 3.6e-14
osteosarcoma -1.704 1.0e-04
ovarian cancer 1.600 2.2e-05
Pick disease -1.100 8.1e-06

Gene RIF (19)

AA Sequence

MWRVCARRAQNVAPWAGLEARWTALQEVPGTPRVTSRSGPAPARRNSVTTGYGGVRALCGWTPSSGATPR      1 - 70
NRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESL     71 - 140
EECYMAKILVAEGTRDVPIGAIICITVGKPEDIEAFKNYTLDSSAAPTPQAAPAPTPAATASPPTPSAQA    141 - 210
PGSSYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG    211 - 280
TRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQVPPPTPPPVAAVPPTPQPLAPTPSAPCPATPAG    281 - 350
PKGRVFVSPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPAPAAVVPPTGPGMAPVPTGVF    351 - 420
TDIPISNIRRVIAQRLMQSKQTIPHYYLSIDVNMGEVLLVRKELNKILEGRSKISVNDFIIKASALACLK    421 - 490
VPEANSSWMDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGVETIANDVVSLATKAREGKLQPHEFQG    491 - 560
GTFTISNLGMFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGAVGAQ    561 - 630
WLAEFRKYLEKPITMLL                                                         631 - 647
//

Text Mined References (47)

PMID Year Title