Property Summary

NCBI Gene PubMed Count 36
Grant Count 66
R01 Count 19
Funding $12,723,488.36
PubMed Score 248.14
PubTator Score 155.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
osteosarcoma -1.704 0.000
medulloblastoma, large-cell 1.400 0.000
hereditary spastic paraplegia -1.298 0.007
non-small cell lung cancer 1.170 0.000
intraductal papillary-mucinous neoplasm ... 2.100 0.001
lung cancer 2.300 0.000
lung adenocarcinoma 1.173 0.000
Pick disease -1.300 0.000
ovarian cancer 1.600 0.000
dermatomyositis -1.200 0.006

Synonym

Accession P10515 Q16783 Q53EP3
Symbols DLTA
PDCE2
PDC-E2

Gene

PANTHER Protein Class (2)

PDB

1Y8N   1Y8O   1Y8P   2PNR   2Q8I   1FYC   2DNE   3B8K   3CRK   3CRL  

Gene RIF (19)

PMID Text
26753982 DLAT interacts with C1QBP in mitochondria.
25043065 ongoing activation of PDCE2-specific B-cells in primary biliary cirrhosis
25042803 Results show that DLAT and ACAT2 as upstream acetyltransferases of K76 and K294 in 6PGD protein.
23543758 These findings were used to identify potentially antigenic sequences within PDC-E2 (an important hepatic autoantigen) that contain a DR0801 motif.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20361979 Solution structure and characterisation of the human pyruvate dehydrogenase complex core assembly
20180236 Data suggest that the catalytic site of pyruvate dehydrogenase complex E2 rather than the previously reported lipoyl binding peptide may contain immunodominant epitopes recognized by antimitochondrial antibodies in primary biliary cirrhosis.
More...

AA Sequence

MWRVCARRAQNVAPWAGLEARWTALQEVPGTPRVTSRSGPAPARRNSVTTGYGGVRALCGWTPSSGATPR      1 - 70
NRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESL     71 - 140
EECYMAKILVAEGTRDVPIGAIICITVGKPEDIEAFKNYTLDSSAAPTPQAAPAPTPAATASPPTPSAQA    141 - 210
PGSSYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEG    211 - 280
TRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQVPPPTPPPVAAVPPTPQPLAPTPSAPCPATPAG    281 - 350
PKGRVFVSPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPAPAAVVPPTGPGMAPVPTGVF    351 - 420
TDIPISNIRRVIAQRLMQSKQTIPHYYLSIDVNMGEVLLVRKELNKILEGRSKISVNDFIIKASALACLK    421 - 490
VPEANSSWMDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGVETIANDVVSLATKAREGKLQPHEFQG    491 - 560
GTFTISNLGMFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGAVGAQ    561 - 630
WLAEFRKYLEKPITMLL                                                         631 - 647
//

Text Mined References (44)

PMID Year Title
26753982 2016 Identification of a novel mitochondrial interacting protein of C1QBP using subcellular fractionation coupled with CoIP-MS.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25525879 2014 Sirtuin 4 is a lipoamidase regulating pyruvate dehydrogenase complex activity.
25043065 2014 Ongoing activation of autoantigen-specific B cells in primary biliary cirrhosis.
25042803 2014 Lysine acetylation activates 6-phosphogluconate dehydrogenase to promote tumor growth.
23543758 2013 Differential binding of pyruvate dehydrogenase complex-E2 epitopes by DRB1*08:01 and DRB1*11:01 Is predicted by their structural motifs and correlates with disease risk.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
More...