Property Summary

NCBI Gene PubMed Count 802
PubMed Score 4598.41
PubTator Score 3127.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 2.81427780452373E-20
lung adenocarcinoma 2714 2.4003283462142E-17
breast carcinoma 1614 1.12196460629522E-16
lung cancer 4473 8.85351357102552E-8
Duchenne muscular dystrophy 602 6.9104531880141E-7
tuberculosis 1563 1.81664375318934E-6
ovarian cancer 8492 8.89044753147867E-6
adrenocortical carcinoma 1427 4.09754828706726E-5
pancreatic cancer 2300 5.52588371121305E-5
limb girdle muscular dystrophy 2B 74 7.6027923945931E-5
ductal carcinoma in situ 1745 7.96624710004792E-5
primary pancreatic ductal adenocarcinoma 1271 8.88256236667431E-5
glioblastoma 5572 1.97741476404821E-4
invasive ductal carcinoma 2950 3.14198500488179E-4
ulcerative colitis 2087 3.96204518201471E-4
Becker muscular dystrophy 187 5.34468900455155E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 5.69906527909859E-4
Down syndrome 548 0.00131300309311584
interstitial cystitis 2299 0.00213507924047053
permanent atrial fibrillation 44 0.00346605743857666
pediatric high grade glioma 2712 0.00462065296790968
psoriasis 6685 0.00518814212930999
posterior fossa group A ependymoma 1511 0.00972749125203391
cutaneous lupus erythematosus 1056 0.0123291964025017
esophageal adenocarcinoma 737 0.0176010007179145
acute quadriplegic myopathy 1157 0.02103928077373
nasopharyngeal carcinoma 1056 0.0295091058828297
non diabetic and post-ischemic heart failure 200 0.0304095430416544
pilocytic astrocytoma 3086 0.0311571429618803
Breast cancer 3099 0.0313596210725524
Endometriosis 535 0.033037119424062
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.033583426645698
gastric carcinoma 832 0.0411659144812165
sarcoidosis 368 0.0465987513900895

Expression

Synonym

Accession P10451 B2RDA1 Q15681 Q15682 Q15683 Q4W597 Q567T5 Q8NBK2 Q96IZ1
Symbols OPN
BNSP
BSPI
ETA-1

Gene

PDB

3CXD   3DSF  

  Ortholog (10)

Gene RIF (769)

PMID Text
26986465 Using plasma samples from hepatocellular carcinoma patients and liver cirrhosis control patients, plasma AFP, PIVKA-II, OPN and DKK-1 levels were measured. The sensitivity and specificity for OPN biomarker was 46.2% and 80.3% (OPN>100 ng/mL).
26840958 Inhibition of Cellular Adhesion by Immunological Targeting of Osteopontin Neoepitopes Generated through Matrix Metalloproteinase and Thrombin Cleavage.
26823725 OPN is constitutively expressed in highly invasive human choriocarcinoma cell lines, promoting neoplasm invasiveness via MMP9.
26821678 fibroblast expression patterns of Tiam1 and osteopontin in human breast cancers show converse changes correlating with invasion, supporting the hypothesis that this pathway in tumor-associated fibroblasts regulates breast cancer invasiveness
26811408 OPN expression is associated with good prognostic features in Medullary thyroid carcinoma.
26731746 OPN can contribute to the impairment of innate host defense by interfering with the function of antimicrobial proteins, thus increasing the vulnerability to acquire infections during COPD.
26701868 Polycystic ovary syndrome is associated with increased OPN levels.
26698858 Low serum osteopontin levels are associated with good response to tocilizumab treatment for Rheumatoid Arthritis.
26656246 SPP1 rs4754 polymorphism may be related to risk of fracture, but not rs6840362
26600502 RNAi based on different segments of the OPN gene had different down-regulatory effects on OPN expression.
More...

AA Sequence

MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFK      1 - 70
QETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDL     71 - 140
PATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQD    141 - 210
LNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHS    211 - 280
HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN                                        281 - 314
//

Text Mined References (809)

PMID Year Title
26986465 2016 Diagnostic Performance of Alpha-Fetoprotein, Protein Induced by Vitamin K Absence, Osteopontin, Dickkopf-1 and Its Combinations for Hepatocellular Carcinoma.
26840958 2016 Inhibition of Cellular Adhesion by Immunological Targeting of Osteopontin Neoepitopes Generated through Matrix Metalloproteinase and Thrombin Cleavage.
26823725 2015 Osteopontin facilitates invasion in human trophoblastic cells via promoting matrix metalloproteinase-9 in vitro.
26821678 2016 The fibroblast Tiam1-osteopontin pathway modulates breast cancer invasion and metastasis.
26811408 2016 Osteopontin expression is correlated with differentiation and good prognosis in medullary thyroid carcinoma.
26731746 2016 Osteopontin That Is Elevated in the Airways during COPD Impairs the Antibacterial Activity of Common Innate Antibiotics.
26701868 2016 Polycystic ovary syndrome is associated with increased osteopontin levels.
26698858 2015 Baseline Serum Osteopontin Levels Predict the Clinical Effectiveness of Tocilizumab but Not Infliximab in Biologic-Naïve Patients with Rheumatoid Arthritis: A Single-Center Prospective Study at 1 Year (the Keio First-Bio Cohort Study).
26656246 2015 The Effect of Polymorphisms in SPP1 on Risk of Fracture: A Case-Control Study.
26600502 2015 Segment-specific targeting via RNA interference mediates down-regulation of OPN expression in hepatocellular carcinoma cells.
More...