Property Summary

NCBI Gene PubMed Count 876
PubMed Score 4916.51
PubTator Score 3127.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (34)

Disease log2 FC p
Duchenne muscular dystrophy 3.166 6.9e-07
acute quadriplegic myopathy 1.328 2.1e-02
adrenocortical carcinoma 3.731 4.1e-05
Astrocytoma, Pilocytic 1.300 3.0e-02
Becker muscular dystrophy 1.667 5.3e-04
Breast cancer 1.700 2.8e-04
breast carcinoma 2.300 6.5e-04
cutaneous lupus erythematosus 3.000 1.2e-02
Down syndrome 2.200 1.3e-03
ductal carcinoma in situ 4.100 8.0e-05
Endometriosis -2.306 3.3e-02
esophageal adenocarcinoma 2.400 1.8e-02
gastric carcinoma 4.200 4.1e-02
glioblastoma 1.600 3.0e-04
interstitial cystitis 2.900 2.1e-03
intraductal papillary-mucinous adenoma (... -4.900 5.7e-04
intraductal papillary-mucinous carcinoma... -3.100 3.4e-02
invasive ductal carcinoma 3.990 3.4e-05
limb girdle muscular dystrophy 2A 2.632 2.0e-04
lung adenocarcinoma 4.300 1.1e-18
lung cancer 4.900 5.2e-07
nasopharyngeal carcinoma 2.300 3.0e-02
non diabetic and post-ischemic heart fai... -1.900 3.0e-02
non-small cell lung cancer 4.319 2.8e-20
ovarian cancer 5.200 8.9e-06
pancreatic cancer 2.200 5.5e-05
pediatric high grade glioma 1.700 4.6e-03
permanent atrial fibrillation 1.700 3.5e-03
posterior fossa group A ependymoma 1.200 9.7e-03
primary pancreatic ductal adenocarcinoma 2.157 8.9e-05
psoriasis 2.400 5.2e-03
sarcoidosis 4.500 4.7e-02
tuberculosis -5.400 1.8e-06
ulcerative colitis 3.700 4.0e-04

Protein-protein Interaction (1)

Gene RIF (838)

AA Sequence

MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFK      1 - 70
QETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDL     71 - 140
PATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQD    141 - 210
LNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHS    211 - 280
HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN                                        281 - 314
//

Text Mined References (881)

PMID Year Title