Property Summary

NCBI Gene PubMed Count 802
Grant Count 885
R01 Count 525
Funding $110,786,737.26
PubMed Score 4598.41
PubTator Score 3127.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (83)

Disease Z-score Confidence
Cancer 2,346 5.469 2.7
Kidney disease 396 5.244 2.6
Osteoporosis 257 4.86 2.4
Atherosclerosis 275 4.278 2.1
Calcinosis 62 4.123 2.1
Arthritis 248 3.889 1.9
diabetes mellitus 1,663 3.722 1.9
Ankylosis 25 3.718 1.9
Multiple Sclerosis 498 3.69 1.8
Hypertension 287 3.609 1.8
Heart disease 279 3.605 1.8
Mouth disease 6 3.512 1.8
Hyperphosphatemia 32 3.425 1.7
Liver disease 219 3.4 1.7
Coronary artery disease 240 3.331 1.7
Ureteral disease 23 3.302 1.7
Hypersensitivity reaction type II diseas... 235  3.226 1.6
Hypophosphatasia 10 3.178 1.6
Rickets 42 3.112 1.6
Acute kidney injury 65
Adenocarcinoma 115
Adverse reaction to drug 54
Alcoholic Liver Diseases 3
Becker muscular dystrophy 187
Brain Neoplasms 23
Breast cancer 3,094
Cerebral Hemorrhage 27
Dermatitis, Allergic Contact 66
Diabetic Cardiomyopathies 10
Down syndrome 548
Drug-Induced Liver Injury 118
Duchenne muscular dystrophy 602
Endometriosis 535
Focal glomerulosclerosis 22
Glioma 65
Heart Diseases 42
Heart valve disease 24
Hypersensitivity 63
Kidney Calculi 7
Leukoencephalopathies 7
Liver Cirrhosis 101
Liver Neoplasms, Experimental 48
Lung Neoplasms 171
Lytic lesion 7
Mammary Neoplasms 410
Mammary Neoplasms, Experimental 150
Mesothelioma 40
Neoplasm Metastasis 138
Neoplasms, Experimental 33
Pancreatic Diseases 6
Pneumonia 133
Proteinuria 63
Pulmonary Fibrosis 66
Uremia 19
acute quadriplegic myopathy 1,157
adrenocortical carcinoma 1,427
breast carcinoma 1,614
cutaneous lupus erythematosus 1,056
ductal carcinoma in situ 1,745
esophageal adenocarcinoma 737
gastric carcinoma 832
glioblastoma 5,572
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
invasive ductal carcinoma 2,950
limb girdle muscular dystrophy 2B 74
lung adenocarcinoma 2,713
lung cancer 4,466
nasopharyngeal carcinoma 1,056
non diabetic and post-ischemic heart fai... 200 
non-small cell lung cancer 2,798
ovarian cancer 8,484
pancreatic cancer 2,300
pediatric high grade glioma 2,712
permanent atrial fibrillation 44
pilocytic astrocytoma 3,086
posterior fossa group A ependymoma 1,511
primary pancreatic ductal adenocarcinoma 1,271
psoriasis 6,685
sarcoidosis 358
tuberculosis 1,557
ulcerative colitis 2,087

Expression

Synonym

Accession P10451 B2RDA1 Q15681 Q15682 Q15683 Q4W597 Q567T5 Q8NBK2 Q96IZ1
Symbols OPN
BNSP
BSPI
ETA-1

Gene

PDB

3CXD   3DSF  

Gene RIF (769)

PMID Text
26986465 Using plasma samples from hepatocellular carcinoma patients and liver cirrhosis control patients, plasma AFP, PIVKA-II, OPN and DKK-1 levels were measured. The sensitivity and specificity for OPN biomarker was 46.2% and 80.3% (OPN>100 ng/mL).
26840958 Inhibition of Cellular Adhesion by Immunological Targeting of Osteopontin Neoepitopes Generated through Matrix Metalloproteinase and Thrombin Cleavage.
26823725 OPN is constitutively expressed in highly invasive human choriocarcinoma cell lines, promoting neoplasm invasiveness via MMP9.
26821678 fibroblast expression patterns of Tiam1 and osteopontin in human breast cancers show converse changes correlating with invasion, supporting the hypothesis that this pathway in tumor-associated fibroblasts regulates breast cancer invasiveness
26811408 OPN expression is associated with good prognostic features in Medullary thyroid carcinoma.
26731746 OPN can contribute to the impairment of innate host defense by interfering with the function of antimicrobial proteins, thus increasing the vulnerability to acquire infections during COPD.
26701868 Polycystic ovary syndrome is associated with increased OPN levels.
26698858 Low serum osteopontin levels are associated with good response to tocilizumab treatment for Rheumatoid Arthritis.
26656246 SPP1 rs4754 polymorphism may be related to risk of fracture, but not rs6840362
26600502 RNAi based on different segments of the OPN gene had different down-regulatory effects on OPN expression.
More...

AA Sequence

MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFK      1 - 70
QETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDL     71 - 140
PATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQD    141 - 210
LNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHS    211 - 280
HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN                                        281 - 314
//

Text Mined References (809)

PMID Year Title
26986465 2016 Diagnostic Performance of Alpha-Fetoprotein, Protein Induced by Vitamin K Absence, Osteopontin, Dickkopf-1 and Its Combinations for Hepatocellular Carcinoma.
26840958 2016 Inhibition of Cellular Adhesion by Immunological Targeting of Osteopontin Neoepitopes Generated through Matrix Metalloproteinase and Thrombin Cleavage.
26823725 2015 Osteopontin facilitates invasion in human trophoblastic cells via promoting matrix metalloproteinase-9 in vitro.
26821678 2016 The fibroblast Tiam1-osteopontin pathway modulates breast cancer invasion and metastasis.
26811408 2016 Osteopontin expression is correlated with differentiation and good prognosis in medullary thyroid carcinoma.
26731746 2016 Osteopontin That Is Elevated in the Airways during COPD Impairs the Antibacterial Activity of Common Innate Antibiotics.
26701868 2016 Polycystic ovary syndrome is associated with increased osteopontin levels.
26698858 2015 Baseline Serum Osteopontin Levels Predict the Clinical Effectiveness of Tocilizumab but Not Infliximab in Biologic-Naïve Patients with Rheumatoid Arthritis: A Single-Center Prospective Study at 1 Year (the Keio First-Bio Cohort Study).
26656246 2015 The Effect of Polymorphisms in SPP1 on Risk of Fracture: A Case-Control Study.
26600502 2015 Segment-specific targeting via RNA interference mediates down-regulation of OPN expression in hepatocellular carcinoma cells.
More...