Property Summary

Ligand Count 930
NCBI Gene PubMed Count 1,649
PubMed Score 130.56
PubTator Score 12509.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
AIDS-related Kaposi sarcoma 1 0.0 0.0
Adenocarcinoma 122 0.0 0.0
Adenocarcinoma, Clear Cell 2 0.0 0.0
Adenoma 167 0.0 0.0
Alzheimer Disease 83 0.0 0.0
Asthma 385 0.0 0.0
Autistic Disorder 364 0.0 0.0
Azoospermia 110 0.0 0.0
Breast Neoplasms 445 0.0 0.0
Carcinoma 11493 0.0 0.0
Cell Transformation, Neoplastic 97 0.0 0.0
Cerebral Hemorrhage 42 0.0 0.0
Chondrosarcoma, Mesenchymal 5 0.0 0.0
Colonic Neoplasms 142 0.0 0.0
Colorectal Neoplasms 243 0.0 0.0
Dermatitis, Allergic Contact 67 0.0 0.0
Dermatitis, Contact 71 0.0 0.0
Diabetes Mellitus, Experimental 108 0.0 0.0
Diabetes Mellitus, Type 2 142 0.0 0.0
Disease Progression 136 0.0 0.0
Erectile dysfunction 32 0.0 0.0
Esophageal Neoplasms 69 0.0 0.0
Gallbladder Neoplasms 10 0.0 0.0
Head and Neck Neoplasms 26 0.0 0.0
Hypertension 396 0.0 0.0
Infertility, Male 46 0.0 0.0
Intestinal Neoplasms 12 0.0 0.0
Learning Disorders 29 0.0 0.0
Leukemia, Lymphocytic, Chronic, B-Cell 34 0.0 0.0
Leukemia, Myeloid, Acute 105 0.0 0.0
Liver Cirrhosis, Alcoholic 16 0.0 0.0
Liver Neoplasms, Experimental 59 0.0 0.0
Lymphoma, Follicular 18 0.0 0.0
Lymphoma, Large B-Cell, Diffuse 34 0.0 0.0
Lymphoma, Non-Hodgkin 24 0.0 0.0
Memory Disorders 40 0.0 0.0
Mesothelioma, Malignant 105 0.0 0.0
Metaplasia 5 0.0 0.0
Multiple myeloma 1332 0.0 0.0
Myocardial Infarction 151 0.0 0.0
Necrosis 53 0.0 0.0
Nerve Degeneration 121 0.0 0.0
Osteochondrodysplasias 72 0.0 0.0
Polycystic ovary syndrome 360 0.0 0.0
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma 25 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Reperfusion Injury 86 0.0 0.0
Retinal Degeneration 106 0.0 0.0
Sarcoma, Synovial 5 0.0 0.0
Soft Tissue Neoplasms 3 0.0 0.0
Disease Target Count
Chronic lymphoid leukemia, disease 13
Disease Target Count Z-score Confidence
Immune system cancer 140 0.0 1.3
Lymphoid leukemia 160 0.0 1.3
Disease Target Count Z-score Confidence
Cancer 2499 3.587 1.8
Disease Target Count Z-score Confidence
beta-mannosidosis 9 3.892 1.9

Expression

  Differential Expression (20)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.534 7.5e-04
malignant mesothelioma 1.100 1.7e-04
Breast cancer 2.500 2.5e-02
colon cancer -2.200 2.5e-04
ductal carcinoma in situ -1.200 4.9e-02
gastric cancer 1.200 3.0e-03
glioblastoma -1.100 1.5e-02
group 4 medulloblastoma -1.800 1.7e-04
intraductal papillary-mucinous carcinoma... -1.800 7.9e-03
intraductal papillary-mucinous neoplasm ... -1.900 1.9e-02
lung cancer -1.500 9.2e-03
medulloblastoma, large-cell -1.900 1.8e-06
osteosarcoma -1.824 1.4e-03
ovarian cancer -3.200 7.9e-10
pituitary cancer -3.000 5.6e-09
primary Sjogren syndrome 1.300 1.4e-03
psoriasis -1.700 7.0e-09
sarcoidosis 1.100 1.3e-02
tuberculosis 1.700 1.4e-04
urothelial carcinoma -2.000 6.4e-03

Protein-protein Interaction (8)

Gene RIF (1547)

AA Sequence

MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTS      1 - 70
PLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD     71 - 140
GVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLF    141 - 210
DFSWLSLKTLLSLALVGACITLGAYLGHK                                             211 - 239
//

Text Mined References (1655)

PMID Year Title