Property Summary

NCBI Gene PubMed Count 1,540
Grant Count 7
R01 Count 3
Funding $1,596,585.38
PubMed Score 123.84
PubTator Score 12509.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (71)

Disease Z-score Confidence
beta-mannosidosis 9 3.921 2.0
Cancer 2,346 3.452 1.7
AIDS with Kaposi's sarcoma 1
Adenocarcinoma 115
Adenocarcinoma, Clear Cell 2
Adenoma 165
Alzheimer's disease 644
Asthma 349
Autistic Disorder 320
Azoospermia 89
Breast cancer 3,094
Cerebral Hemorrhage 27
Chondrosarcoma, Mesenchymal 5
Chronic Lymphocytic Leukemia 242
Chronic lymphoid leukemia, disease 10
Colonic Neoplasms 126
Colorectal Neoplasms 217
Contact Dermatitis 80
Dermatitis, Allergic Contact 66
Diabetes Mellitus, Experimental 106
Diabetes Mellitus, Non-Insulin-Dependent 157
Diffuse large B-cell lymphoma 41
Disease Progression 125
Erectile dysfunction 10
Esophageal Neoplasms 67
Head and Neck Neoplasms 23
Hypertensive disease 193
Immune system cancer 38 1.0
Intestinal Neoplasms 11
Learning Disorders 27
Leukemia, Myelocytic, Acute 113
Liver Cirrhosis, Alcoholic 16
Liver Neoplasms, Experimental 48
Lymphoid leukemia 69 1.0
Lymphoma, Follicular 20
Lymphoma, Non-Hodgkin 22
Male infertility 170
Mammary Neoplasms 410
Memory Disorders 36
Metaplasia 3
Multiple myeloma 1,327
Myocardial Infarction 126
Necrosis 51
Neoplastic Cell Transformation 81
Nerve Degeneration 73
Osteochondrodysplasias 15
Polycystic Ovary Syndrome 332
Prostatic Neoplasms 471
Reperfusion Injury 84
Retinal Degeneration 49
Soft Tissue Neoplasms 3
Synovial sarcoma 25
colon cancer 1,475
ductal carcinoma in situ 1,745
gallbladder neoplasm 9
gastric cancer 430
glioblastoma 5,572
group 4 medulloblastoma 1,875
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
lung cancer 4,466
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
osteosarcoma 7,933
ovarian cancer 8,484
pituitary cancer 1,972
primary Sjogren syndrome 789
psoriasis 6,685
sarcoidosis 358
tuberculosis 1,557
urothelial carcinoma 318

Expression

  Differential Expression (20)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.534 0.001
gastric cancer 1.200 0.003
urothelial carcinoma -2.000 0.006
malignant mesothelioma 6.100 0.000
psoriasis -1.700 0.000
osteosarcoma -1.824 0.001
glioblastoma -1.100 0.015
medulloblastoma, large-cell -1.900 0.000
tuberculosis 1.700 0.000
intraductal papillary-mucinous carcinoma... -1.800 0.008
intraductal papillary-mucinous neoplasm ... -1.900 0.019
lung cancer -3.600 0.000
colon cancer -2.500 0.009
sarcoidosis 1.100 0.013
Breast cancer 2.500 0.025
group 4 medulloblastoma -1.800 0.000
primary Sjogren syndrome 1.300 0.001
ductal carcinoma in situ -1.200 0.049
ovarian cancer -3.200 0.000
pituitary cancer -3.000 0.000

Synonym

Accession P10415 C9JHD5 P10416 Q13842 Q16197
Symbols Bcl-2
PPP1R50

Gene

PANTHER Protein Class (1)

PDB

5AGW   5AGX   4AQ3   4IEH   1G5M   1GJH   1YSW   2O21   2O22   2O2F   2W3L   2XA0   4LVT   4LXD   4MAN   5FCG  

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
950 screening 116 / 437 / 194222 Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-2.
1328 confirmatory 9 / 0 / 825 Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-2
2075 confirmatory 6 / 0 / 36 Confirmation dose response of hits from multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-2
504627 other 0 / 0 / 0 Bcl-2 family members Fluorescence polarization assay with Set1 of powder compounds

Gene RIF (1450)

PMID Text
27141571 Renal Bcl-2 expression is decreased in diabetes.
27008505 RBP2 promotion of overexpression and activation in acute lymphoblastic leukemia development and progression
26963620 This study examined the immunohistochemical expression of ki-67, p53 and BCL2 in infiltrating lobular breast carcinoma.
26956214 Bcl-2 is required for efficient intestinal transformation.
26884845 Bcl-2 may play a role in vasculogenic mimicry through miRNAs by targeting angiogenesis associated genes in hepatocellular carcinomas.
26884837 MiR-15b can inhibit HepG2 cell proliferation and down-regulate BCL2 mRNA and protein expression.
26881923 These results indicate that the BCL2 -938C>A polymorphism influences the occurrence and course of aseptic loosening.
26874859 Bcl-2 dependent NB cell lines are exquisitely sensitive to ABT-199 . Treatment with ABT-199 displaces Bim from Bcl-2 in NB to activate caspase 3, confirming the restoration of mitochondrial apoptosis
26858413 These observations suggest that HBx may modulate Bcl-2 function in a way that is different from that of the classical BH3-only proteins.
26841249 Authors found a new 28-mer G-quadruplex-forming sequence, P1G4, immediately upstream of the human BCL2 gene P1 promoter.
More...

AA Sequence

MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTS      1 - 70
PLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD     71 - 140
GVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLF    141 - 210
DFSWLSLKTLLSLALVGACITLGAYLGHK                                             211 - 239
//

Text Mined References (1546)

PMID Year Title
27141571 Immunohistochemical Aspects of Cell Death in Diabetic Nephropathy.
27008505 2016 RBP2 Promotes Adult Acute Lymphoblastic Leukemia by Upregulating BCL2.
26963620 2016 Breastfeeding and Immunohistochemical Expression of ki-67, p53 and BCL2 in Infiltrating Lobular Breast Carcinoma.
26956214 2016 Bcl-2 is a critical mediator of intestinal transformation.
26884845 2015 Role of Bcl-2 and its associated miRNAs in vasculogenic mimicry of hepatocellular carcinoma.
26884837 2015 MiR-15b mediates liver cancer cells proliferation through targeting BCL-2.
26881923 2016 The BCL2 -938C>A Promoter Polymorphism Is Associated with Risk for and Time to Aseptic Loosening of Total Hip Arthroplasty.
26874859 2016 Select Bcl-2 antagonism restores chemotherapy sensitivity in high-risk neuroblastoma.
26858413 2016 Structural and biochemical analysis of Bcl-2 interaction with the hepatitis B virus protein HBx.
26841249 2016 A New G-Quadruplex with Hairpin Loop Immediately Upstream of the Human BCL2 P1 Promoter Modulates Transcription.
More...