Property Summary

NCBI Gene PubMed Count 37
PubMed Score 42.70
PubTator Score 34.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer 1.400 8.6e-08
diabetes mellitus -1.200 2.9e-03
gastric cancer -1.600 1.9e-02
hepatocellular carcinoma -1.500 5.9e-04
lung adenocarcinoma 1.800 2.8e-08
lung cancer 1.700 4.2e-05
Multiple Sclerosis -1.600 9.2e-05

 OMIM Phenotype (1)

Gene RIF (12)

AA Sequence

MSETAPAAPAAPAPAEKTPVKKKARKSAGAAKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAG      1 - 70
YDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKKAGAAKAKKPAGAAKKPKK     71 - 140
ATGAATPKKSAKKTPKKAKKPAAAAGAKKAKSPKKAKAAKPKKAPKSPAKAKAVKPKAAKPKTAKPKAAK    141 - 210
PKKAAAKKK                                                                 211 - 219
//

Text Mined References (51)

PMID Year Title