Property Summary

NCBI Gene PubMed Count 60
Grant Count 37
R01 Count 15
Funding $5,003,013.11
PubMed Score 268.16
PubTator Score 103.85

Knowledge Summary

Patent (15,436)

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 0.000
glioblastoma 1.500 0.000
pediatric high grade glioma 1.100 0.000
pilocytic astrocytoma 1.200 0.000

 GO Component (1)

Gene RIF (18)

PMID Text
26508523 This review discusses the regulation of A-Raf protein expression, and the roles of A-Raf in apoptosis and cancer, with a special focus on its role in resistance to Raf inhibitors. [review]
25674762 Aberrant expression of A-, B-, and C-RAF, and COT is frequent in PTC; increased expression of COT is correlated with recurrence of PTC.
25608663 analysis of FGFR2-PPHLN1 fusion and ARAF mutations in intrahepatic cholangiocarcinoma
25097033 Dimerization of the kinase ARAF promotes MAPK pathway activation and cell migration.
24652991 The study identifies somatic activating ARAF mutations in Langerhans cell histiocytosis.
24447338 The amplified luminescent proximity homogeneous assay (AlphaScreen) identifies the interaction of HIV-1 Gag with ARAF
24114843 Galpha12-ARAF-ERK pathway stimulates RFFL transcription through the transcription factor c-Myc.
23591895 show that Araf antagonizes mesendoderm induction and patterning activity of Nodal/Smad2 signals in vertebrate embryos by directly inhibiting Smad2 signalling
23352452 Ras pathway activation via EGF treatment induced strong binding between B-Raf and C-Raf and a low level of binding between B-Raf and A-Raf.
22926515 study investigated role of ARAF in cancer cell signaling and examined the role of ARAF in mediating paradoxical activation of the MAPK pathway in cells treated with RAF inhibitors; ARAF seems to stabilize BRAF:CRAF complexes in cells treated with RAF inhibitors and regulate cell signaling in a subtle manner to ensure signaling efficiency
More...

AA Sequence

MEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKT      1 - 70
VTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLFHGFRCQTCGYKFHQHCSSKV     71 - 140
PTVCVDMSTNRQQFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRI    141 - 210
RSTSTPNVHMVSTTAPMDSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRE    211 - 280
RKSLADDKKKVKNLGYRDSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVSQPTAEQAQA    281 - 350
FKNEMQVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYL    351 - 420
HAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQDPNPYSFQS    421 - 490
DVYAYGVVLYELMTGSLPYSHIGCRDQIIFMVGRGYLSPDLSKISSNCPKAMRRLLSDCLKFQREERPLF    491 - 560
PQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLSAARLVP                            561 - 606
//

Text Mined References (70)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26508523 2015 A-Raf: A new star of the family of raf kinases.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25674762 2015 Aberrant expression of COT is related to recurrence of papillary thyroid cancer.
25608663 2015 Massive parallel sequencing uncovers actionable FGFR2-PPHLN1 fusion and ARAF mutations in intrahepatic cholangiocarcinoma.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25097033 2014 Dimerization of the kinase ARAF promotes MAPK pathway activation and cell migration.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24746704 2014 Disruption of CRAF-mediated MEK activation is required for effective MEK inhibition in KRAS mutant tumors.
24652991 2014 Somatic activating ARAF mutations in Langerhans cell histiocytosis.
More...