Property Summary

Ligand Count 4
NCBI Gene PubMed Count 63
PubMed Score 277.62
PubTator Score 103.85

Knowledge Summary

Patent (15,436)

Expression

  Differential Expression (4)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 3.2e-07
atypical teratoid / rhabdoid tumor 1.100 2.9e-05
glioblastoma 1.500 1.2e-06
pediatric high grade glioma 1.100 6.1e-06

 GO Component (2)

Protein-protein Interaction (1)

Gene RIF (19)

AA Sequence

MEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKT      1 - 70
VTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLFHGFRCQTCGYKFHQHCSSKV     71 - 140
PTVCVDMSTNRQQFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRI    141 - 210
RSTSTPNVHMVSTTAPMDSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRE    211 - 280
RKSLADDKKKVKNLGYRDSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVSQPTAEQAQA    281 - 350
FKNEMQVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYL    351 - 420
HAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQDPNPYSFQS    421 - 490
DVYAYGVVLYELMTGSLPYSHIGCRDQIIFMVGRGYLSPDLSKISSNCPKAMRRLLSDCLKFQREERPLF    491 - 560
PQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLSAARLVP                            561 - 606
//

Text Mined References (73)

PMID Year Title